Details for Kale Locus Bo5g143190

Position : C5 ( 5`- 44271150 .. 44272299 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143190

Protein [Map View]
MALVQSRTLPRLTVPFSPVLSTLHAPSSLFLRRKTRPGASPFSSSTAGNLPFSPLTHPRKLLCPPPRGKFVREDYLVRKL
SAQELQELVKGERKVPLIVDFYATWCGPCILMAQELEMLAVEYESNAMIVKVDTDDEYEFARDMQVRGLPTLFFISPDPS
KDAIRTEGLIPIQMMRDIIDNDM*

DNA
ATGGCTCTTGTTCAATCCAGAACACTTCCTCGCCTCACCGTCCCGTTCTCGCCGGTTCTGTCCACACTCCACGCTCCGTC
GTCTCTCTTTCTCCGGAGGAAAACTCGACCGGGAGCCTCGCCGTTCTCCTCCTCCACCGCCGGGAACTTGCCATTCTCGC
CGCTGACGCATCCTCGGAAGCTTCTCTGCCCTCCACCTCGTGGAAAGTTTGTTAGAGAAGATTATCTTGTGAGGAAATTG
TCAGCTCAAGAACTTCAAGAACTGGTGAAAGGAGAGAGGAAGGTGCCGTTGATTGTTGATTTTTATGCTACTTGGTGTGG
ACCTTGTATCTTGATGGCCCAGGAACTCGAAATGCTTGCAGTAGAGTATGAGAGCAATGCAATGATTGTGAAAGTTGATA
CAGATGATGAGTACGAGTTTGCTCGCGACATGCAGGTTCGGGGATTACCTACATTGTTCTTCATCAGTCCTGACCCAAGC
AAAGATGCAATCAGGACAGAAGGGCTGATTCCAATACAGATGATGCGTGACATCATTGACAACGACATGTGA