Details for Kale Locus Bo5g143170

Position : C5 ( 5`- 44256056 .. 44257417 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143170

Protein [Map View]
MDSSNSWINCPSVFSSSSSASRRCQQSRSDLYIGGGYEDLEGEDDLKSEFICPFCAEVFDIVGLCCHIDEEHPVEAKNGV
CPVCTKRVGLDIVGHITTQHANFFKVQRKRRLRKGGGYSSAYLTLKKELREANLQSLLGGSSSFASSTNIDSDPLLSSFM
FNPPSAANKSATPVTEGASATTKLSQKESLKRDIREAPLSGEDREKAKKSEFVRGLFLSTMLGDDY*

DNA
ATGGATTCCTCCAATTCATGGATCAATTGTCCTTCCGTTTTCTCATCCTCTTCTTCTGCTTCGCGACGATGTCAACAATC
CCGATCAGATTTGTATATAGGTGGAGGGTACGAGGATCTCGAAGGAGAAGACGATTTGAAGTCGGAGTTCATCTGCCCGT
TTTGCGCTGAAGTCTTCGACATCGTCGGGCTCTGTTGTCACATTGACGAAGAGCATCCTGTCGAGGCCAAGAACGGGGTC
TGTCCTGTATGCACAAAGAGGGTGGGATTAGATATCGTCGGCCATATCACTACACAACATGCGAACTTTTTCAAGGTGCA
GCGAAAGAGAAGGTTGAGAAAAGGTGGTGGATACAGCTCTGCTTATCTCACCCTCAAGAAAGAGCTTCGTGAAGCTAACT
TACAGTCACTTCTCGGTGGTTCCTCAAGCTTCGCTTCTTCAACCAATATAGATTCTGATCCGTTGCTGTCGTCCTTTATG
TTCAATCCTCCGTCAGCTGCAAACAAATCCGCTACACCTGTTACGGAAGGAGCCTCGGCTACAACAAAACTCTCGCAAAA
GGAGTCTCTCAAAAGAGACATTCGAGAAGCTCCACTTTCAGGGGAAGACAGGGAGAAGGCGAAGAAGAGCGAGTTTGTGA
GAGGTTTGTTCTTGTCAACCATGCTTGGTGACGATTACTAA