Details for Kale Locus Bo5g143160

Position : C5 ( 5`- 44253823 .. 44254431 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143160

Protein [Map View]
MMELSLIVETVSAVCTAKQGVAFGSSLLLLNRWDSANHVSFTADSLVDQSPGGIVQASAAVIFPVDAIAPSPVRSSSYKT
IRRIRKRRRTKRVSYGGDSEDGGDFGRFLLEGGFGGSDGPFGFGGDGGGGKGWNYGGGGGGGSWDESSSSSGSWSDPAME
FVYEVICWIALSNCVHFAFKRIVRIVTDGEREKLNLTLSPVC*

DNA
ATGATGGAGCTCTCTCTGATCGTTGAAACAGTCTCCGCGGTTTGCACGGCCAAGCAAGGCGTAGCGTTCGGGAGCTCTCT
TCTCCTTCTCAATCGGTGGGATTCAGCGAATCACGTTTCGTTCACCGCCGATTCCCTCGTCGATCAGTCTCCGGGTGGAA
TCGTTCAAGCGTCGGCGGCGGTTATCTTCCCCGTCGACGCGATCGCTCCTTCGCCGGTTAGATCTAGCTCTTACAAGACG
ATCCGCAGGATCCGCAAAAGGCGGCGCACGAAGCGCGTCTCGTACGGCGGCGATTCGGAGGACGGTGGAGACTTCGGTCG
GTTTCTGTTAGAAGGCGGTTTCGGTGGGAGCGACGGTCCGTTCGGGTTTGGCGGTGATGGTGGCGGTGGGAAGGGGTGGA
ACTACGGCGGAGGCGGTGGTGGTGGAAGTTGGGATGAGTCGTCTTCGTCGTCTGGGTCTTGGTCGGATCCGGCGATGGAG
TTCGTGTACGAAGTGATTTGCTGGATCGCGTTGTCGAATTGTGTGCATTTCGCGTTCAAGAGGATAGTGAGGATCGTGAC
GGACGGTGAAAGGGAGAAGTTGAACCTGACGTTGTCTCCGGTCTGCTGA