Details for Kale Locus Bo5g143150

Position : C5 ( 5`- 44248396 .. 44252520 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143150

Protein [Map View]
MGSNTGDLVTRVQSAHLFDHDALLRYAADNVSGFPTNPSQFTISQFGHGQSNPTFLIAVGSGSSLKRYVLRKKPPGKLLQ
SAHAVEREFQVLKALGEHTQVPVPKVFCLCTDPTVIGTAFYIMEFMEGRIFIDPKLHNVAPGRRTAIYRAAAKALASLHS
ADVDAIGLDKYGRRANYCQRQIDRWFKQYLASTSEGKPVRNPKMFELVDWLRKSIPAEDSTGATSGLVHGDFRIDNLVFH
PYEDRVIGILDWELSTLGNQMCDLAYSCMHYIVNVQLDKEHVSEGLETTGLPDGILSMPEFLLEYCSALGKPWPAANWKF
YVAFSMFRAASIYTGVYNRWLMGNASAGERARNTGVQANELVECALGYIARENVLPAHPPPVKRHEGPSYESLVDGTGRF
VPNRKVLELREKLIKFMETHIYPMEKEFAKLAQSNLRWTVHPEEERLKEEAKRQGLWNLFIPVDSAARARRELAAIENKQ
SFDQLFGEGLTNLEYGYLCEIMGRSVWAPQVFNCGAPDTGNMEVILRYGNKEQIAEWLIPLLEGKIRSGFAMTEPQVASS
DATNIECSIKRQGDSYIINGTKWWTSGAMDPRCRVLILMGKTDFNAPKHKQQSMILVDMRTPGIHVKRPLTVFGFDDAPH
GHAEISFENVIVPAKNILLGEGRGFEIAQGRLGPGRLHHCMRLIGAAERGMELMAKRALSRKTFGMFIAQHGSFVSDLAK
LRVELEGTRLLVLEAADHLDKFGNKKARGILAMAKVAAPNMALKVLDTAIQVHGAAGVCSDTVLAHLWATARTLRIADGP
DEVHLGTIGKLELQRASKL*

DNA
ATGGGGAGTAACACCGGCGATCTAGTGACACGTGTCCAATCAGCTCATCTGTTCGATCACGACGCCTTGCTCCGTTACGC
CGCCGACAACGTCTCCGGTTTTCCGACCAACCCATCTCAATTCACCATCTCACAGTTCGGACACGGGCAATCGAATCCGA
CCTTTCTGATCGCTGTCGGCTCGGGAAGCTCCCTTAAACGCTACGTTTTGAGGAAGAAACCTCCTGGGAAGCTCTTGCAA
TCTGCTCATGCCGTTGAAAGGGAGTTTCAGGTGCTTAAGGCTCTTGGTGAGCATACACAAGTTCCTGTCCCCAAAGTCTT
CTGCTTATGCACTGACCCCACTGTGATTGGGACTGCTTTTTACATTATGGAGTTTATGGAAGGAAGAATCTTCATAGACC
CCAAGTTGCATAATGTAGCACCCGGGAGAAGAACTGCGATCTATCGTGCAGCCGCCAAAGCCTTAGCCTCTCTTCATTCT
GCTGATGTTGATGCGATTGGTCTTGACAAATACGGTCGGCGCGCAAACTACTGCCAAAGACAGATAGATAGGTGGTTCAA
ACAATACTTGGCTTCAACGAGCGAAGGCAAACCCGTAAGGAATCCAAAGATGTTTGAGCTTGTTGATTGGTTACGCAAAA
GCATACCCGCTGAAGATTCAACTGGGGCAACGTCAGGCCTTGTACACGGAGACTTCCGCATTGACAATCTAGTGTTTCAT
CCTTATGAGGATCGAGTTATTGGAATACTTGACTGGGAACTCTCCACTCTTGGGAACCAAATGTGTGATCTTGCATACAG
CTGTATGCATTACATTGTGAATGTTCAGCTCGATAAGGAGCATGTGAGTGAAGGTCTTGAAACTACTGGACTCCCAGACG
GAATACTTTCTATGCCAGAGTTTCTCTTAGAATACTGTTCTGCATTGGGGAAACCATGGCCTGCGGCAAACTGGAAGTTC
TACGTAGCCTTCTCTATGTTTCGGGCCGCTTCAATCTACACAGGCGTGTACAACAGATGGTTAATGGGGAATGCTTCTGC
CGGTGAACGTGCCAGGAACACAGGTGTTCAAGCCAATGAGCTTGTAGAGTGTGCATTGGGTTATATCGCACGCGAGAATG
TTCTTCCTGCGCACCCTCCACCTGTTAAAAGACATGAGGGCCCATCGTATGAAAGCCTTGTGGATGGAACCGGGAGATTC
GTTCCCAACAGAAAAGTATTGGAGCTAAGGGAGAAGCTGATCAAGTTTATGGAGACTCACATCTACCCGATGGAGAAAGA
GTTCGCCAAACTTGCTCAGTCGAATTTGCGGTGGACCGTTCACCCTGAGGAGGAGAGGTTAAAGGAAGAGGCAAAGAGAC
AAGGCCTATGGAACTTATTTATTCCTGTGGATAGTGCTGCTAGAGCTAGGAGAGAACTGGCAGCTATTGAGAATAAACAA
TCTTTTGATCAATTGTTTGGTGAGGGCCTTACGAACCTGGAGTATGGTTACCTTTGTGAGATCATGGGTCGTTCGGTTTG
GGCTCCACAGGTGTTCAACTGTGGTGCACCTGATACTGGAAACATGGAGGTGATACTTCGGTATGGAAACAAAGAACAAA
TTGCTGAATGGCTGATTCCGCTGCTTGAAGGAAAGATCCGTTCTGGATTTGCTATGACTGAGCCACAAGTTGCATCGTCT
GATGCAACCAATATTGAGTGCTCTATTAAAAGACAAGGTGATTCATACATCATCAATGGCACAAAATGGTGGACAAGTGG
AGCCATGGATCCAAGGTGCAGAGTGCTTATTCTCATGGGAAAAACTGATTTCAACGCCCCAAAACATAAGCAACAGTCTA
TGATACTAGTGGACATGCGGACTCCAGGTATACACGTGAAGAGACCTCTCACGGTGTTTGGTTTTGACGACGCGCCTCAT
GGACATGCTGAGATTTCTTTTGAGAATGTGATTGTCCCGGCGAAGAATATTCTCCTAGGAGAAGGCCGAGGATTCGAGAT
TGCTCAGGGAAGGTTAGGCCCTGGAAGATTGCACCATTGCATGAGACTAATAGGTGCAGCAGAGCGTGGGATGGAGCTAA
TGGCTAAAAGAGCTCTTAGCAGGAAGACTTTTGGGATGTTTATAGCGCAGCACGGTTCTTTTGTCTCTGATCTTGCAAAG
TTGCGAGTAGAGCTGGAAGGAACCAGATTGTTAGTACTAGAAGCTGCTGATCATCTCGATAAGTTTGGGAACAAAAAAGC
TAGAGGGATTCTCGCAATGGCCAAGGTTGCAGCTCCAAACATGGCGTTGAAGGTACTAGACACGGCTATTCAAGTTCATG
GAGCAGCCGGTGTGTGCTCGGATACAGTTTTGGCGCATCTGTGGGCCACGGCTAGAACGCTCAGGATTGCTGATGGACCT
GACGAGGTTCATCTTGGGACCATTGGCAAGTTAGAGTTACAGAGAGCTTCAAAGCTTTAA