Details for Kale Locus Bo5g143130

Position : C5 ( 5`- 44234902 .. 44239268 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143130

Protein [Map View]
SLSLSLSLSLFISSHLLRFYLYLYPSFDSQSQRRRSTREIRNRARRMASRTKGKTTMEVGGDGVAVITLINPPVNSLSFD
VLENLKSNYEEALSRNDVKAIVITGAKGRFSGGFDISGFGDIQKGTRKAPKPGHISIDIITDLLEAAKKPSVAAIDGLAL
GGGLELAMACHARISAPGAQLGLPELQLGVIPGFGGTQRLPRLVGLTKALEMILTSKPVKAEQGHSLGLVDAVVPPAELL
NAARRWALDIAERRKPWVSSVLKTDKLPPLGEAREILKFAKDQTRRQAPNLKHPLMCLEAVEVGIVSGSRAGLEKEALIS
SQVVKLDTTKSLIHVFFSQRGTTKVPGVTDRGLVPRKIKKVAIIGGGLMGSGIATALILSNYPVILKEVNEKFLEAGLGR
VKANLQSSVKKGRMSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVIENISLKQQIFADLEKYCPQHCILASNTSTIDLNK
IGERTKSQDRIIGAHFFSPAHVMPLLEIVRTNHTSAQVIVDLLDVGKKIKKTPVVVGNCTGFAVNRMFFPYTQAAMFLVE
RGTDPYLIDKAVSKFGMPMGPFRLCDLVGFGVAIATATQFIENFPERTNKSMIIPLMQEDKRAGEATRKGFYLYDEKRKA
KPDPEIKKYIEKARSVSGVNLDPKLAKLSEKEIIEMTFFPVVNEACRVFAEGIAVKAADLDIAGIFGMGFPPYRGGIMFW
ADSIGSKYIYSKLDEWSKAYGGFFKPCDFLAERGSKGAPLSAPLEQARSRL*

DNA
TCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTTTATATCGAGTCATCTCCTCCGTTTCTATTTATATCTGTATCCCAGTTT
TGACTCGCAATCTCAGCGAAGAAGATCGACGAGAGAAATACGAAACCGAGCTCGAAGAATGGCGTCACGAACGAAGGGAA
AGACGACGATGGAAGTTGGAGGCGATGGCGTCGCCGTCATAACGCTCATCAACCCTCCCGTCAATTCGCTATCATTCGAC
GTGCTAGAGAACCTTAAAAGTAATTACGAGGAGGCCTTGAGCAGGAATGATGTTAAAGCTATTGTTATTACGGGTGCCAA
GGGGAGGTTCTCTGGTGGATTTGATATATCTGGTTTTGGTGATATTCAGAAAGGGACAAGAAAAGCGCCAAAGCCTGGAC
ACATATCAATTGACATCATCACCGATTTGCTTGAAGCTGCAAAAAAACCGTCTGTTGCTGCCATTGATGGGCTTGCCTTG
GGAGGAGGGTTAGAGCTCGCAATGGCTTGCCATGCAAGGATCTCAGCCCCTGGTGCACAGTTAGGTCTGCCGGAGCTGCA
ACTCGGTGTTATTCCTGGGTTTGGAGGAACACAGCGTCTTCCACGTCTTGTTGGTCTTACAAAAGCCCTTGAGATGATTT
TGACTTCTAAGCCGGTTAAAGCTGAGCAAGGTCATTCATTGGGTCTTGTTGATGCTGTCGTGCCACCTGCCGAGTTACTA
AACGCTGCTCGTCGCTGGGCTCTTGACATAGCCGAGAGGAGAAAACCATGGGTTTCTAGTGTTTTGAAGACTGATAAGTT
ACCTCCTCTTGGAGAGGCAAGGGAGATACTGAAGTTTGCCAAGGATCAGACACGCAGGCAAGCCCCTAACCTGAAACACC
CCTTAATGTGCCTTGAGGCTGTTGAAGTGGGTATTGTTTCTGGTTCTAGGGCTGGTTTAGAAAAGGAGGCTCTAATCTCC
TCACAAGTGGTCAAGCTGGATACCACCAAAAGCTTGATCCATGTCTTCTTTTCTCAGCGAGGAACTACAAAGGTTCCTGG
AGTTACTGATCGTGGGTTGGTGCCAAGGAAGATTAAAAAGGTAGCCATAATTGGAGGCGGGTTAATGGGATCTGGCATAG
CCACTGCATTGATCCTCAGTAACTATCCAGTGATTCTCAAGGAGGTAAATGAGAAGTTCTTGGAGGCTGGACTTGGCAGG
GTCAAAGCTAATCTTCAGAGCAGTGTAAAGAAAGGAAGGATGTCTCAGGAAAAGTTTGAGAAAACCATGTCACTCCTTAA
AGGTTCTCTTGACTATGAAAGCTTTAGGGATGTGGACATGGTCATCGAGGCTGTCATTGAGAATATATCATTGAAACAGC
AAATTTTTGCTGATCTAGAGAAGTACTGTCCTCAACATTGTATCCTTGCTAGCAACACATCTACCATTGATTTGAACAAA
ATTGGGGAGCGGACCAAGTCCCAGGATCGGATTATTGGAGCACATTTTTTCAGTCCGGCACATGTCATGCCACTACTTGA
AATAGTTCGGACCAATCATACATCTGCACAAGTAATTGTTGACCTGTTAGATGTTGGGAAGAAGATCAAGAAAACGCCAG
TGGTGGTGGGAAACTGCACAGGGTTTGCAGTTAACAGGATGTTCTTTCCATACACACAGGCAGCTATGTTCCTTGTTGAA
CGTGGAACAGATCCATATCTGATTGACAAGGCAGTCAGCAAGTTTGGAATGCCAATGGGTCCCTTCAGATTGTGCGATTT
GGTTGGATTCGGTGTGGCGATTGCAACCGCTACGCAATTCATCGAGAACTTTCCAGAAAGGACAAACAAATCAATGATTA
TCCCACTCATGCAAGAGGACAAGAGAGCTGGTGAAGCCACTCGTAAAGGTTTCTATCTTTACGATGAAAAGCGAAAGGCT
AAACCTGATCCTGAGATTAAGAAATATATCGAGAAGGCAAGGAGCGTATCAGGAGTGAACCTTGACCCTAAGCTGGCAAA
ACTGTCGGAAAAGGAGATTATTGAGATGACGTTTTTCCCAGTAGTGAACGAGGCTTGTAGAGTTTTTGCGGAAGGGATTG
CTGTCAAAGCAGCAGACCTTGACATCGCTGGCATATTTGGGATGGGGTTTCCACCTTACAGAGGAGGAATCATGTTCTGG
GCTGATTCCATTGGATCGAAATACATTTACTCAAAGCTGGATGAGTGGTCGAAGGCTTATGGTGGTTTCTTCAAGCCTTG
TGATTTCTTAGCTGAAAGGGGATCTAAAGGAGCTCCTCTCAGTGCTCCCTTGGAACAAGCCAGATCGCGGTTGTAA