Details for Kale Locus Bo5g143120

Position : C5 ( 5`- 44230847 .. 44231908 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g143120

Protein [Map View]
MVDLKDQDMGDGMQCTTHPYTKNPGGICPLCLQEKLGKLVTSSFPLPKPNHLSASSSSKSFSPSSTTSLALSLSSGRDSN
NNNNNLPFLLAKKKSILAAASSSSSSSSASLIYKRSKSSAAAYGESLNRKKRSGFWSFLHLYSSKHQIAAATTKKVSHPS
VPRNQTTETSNKVVGGGIDVIVEEEDESSSSNKVVVETPVSSVGSGAGGSSLERKVLRSRSVGCGSRSFSGDFFERISNG
FGDCALKRIESQREHTKAISNGEAADAMSEMVKCGGIFGGFMIMTSSSSSTSASSTVDHHHHKMGNKSAWGRAFASPMRA
KSVHKGGTTTESSTDKNTTPNLNSTPSLVTMKS*

DNA
ATGGTGGACCTCAAAGATCAAGACATGGGAGATGGGATGCAATGCACAACACATCCTTACACAAAGAACCCAGGTGGTAT
CTGCCCACTATGTCTCCAAGAAAAGCTCGGTAAGCTCGTCACTTCCTCTTTCCCTCTCCCTAAACCAAACCACCTCTCTG
CTTCCTCTTCTTCTAAATCCTTCTCTCCTTCTTCCACCACCTCTCTTGCTCTATCTCTCTCATCGGGAAGAGACAGCAAC
AACAACAACAACAACCTCCCGTTTCTTCTTGCCAAGAAGAAGAGCATTCTCGCAGCTGCTTCTTCATCCTCATCCTCTTC
TTCGGCTAGTCTTATCTACAAGAGAAGCAAATCTTCGGCTGCTGCTTACGGTGAGAGTTTAAACCGCAAGAAACGAAGTG
GGTTCTGGTCGTTTCTTCATCTCTACTCTTCCAAACACCAAATAGCTGCCGCCACCACCAAAAAAGTTAGCCATCCTTCG
GTGCCAAGAAACCAGACAACAGAGACATCTAACAAGGTTGTTGGTGGAGGCATTGATGTGATAGTGGAGGAAGAAGATGA
GAGCTCTAGTAGTAACAAAGTTGTTGTAGAAACACCAGTTAGCAGTGTTGGTAGTGGTGCTGGTGGCTCGTCTTTAGAGA
GGAAAGTATTGAGATCTAGATCCGTAGGGTGTGGAAGCAGAAGCTTCTCTGGTGATTTCTTTGAGAGGATCTCTAACGGG
TTTGGAGACTGCGCCTTGAAAAGGATTGAGTCACAAAGAGAACACACAAAGGCCATTAGTAATGGTGAAGCAGCTGATGC
TATGAGTGAGATGGTGAAATGTGGTGGTATCTTTGGTGGGTTTATGATTATGACATCATCCTCATCATCAACTTCAGCAT
CATCAACGGTTGATCATCATCACCATAAGATGGGGAATAAAAGCGCATGGGGAAGGGCGTTTGCAAGTCCAATGAGAGCC
AAGAGTGTTCATAAAGGTGGTACTACTACGGAGTCTTCAACTGACAAAAACACAACTCCAAACTTGAATTCAACTCCTTC
ATTGGTTACTATGAAAAGCTAA