Details for Kale Locus Bo5g142970

Position : C5 ( 5`- 44154440 .. 44156496 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g142970

Protein [Map View]
MSQPNNNNGDDDKRYKKIFVGGLAWSVTTDVLRSFFQEKCGEVLEANVVSETLPDGNLKSKGYGFVTFRDVAAATRACQP
PYPDIEGRRTNINLAYVNAKNNPNHSNQTGLLQQAGPSHQYQHGPFNQMAWHQYQNGWFNQVAWQQYPQFCTNPQFPLVY
WDSYRGAYIQIPHHPCSSNMNWHQTHSVRPPGMSQPPTEPRFEELPADTNQEAVSTADGVSNDNKEEVDTETDNGADQQN
GKAQEGEISGQNNGIKQDVKDQEGEINGQDNGIKQDVKDEEGKIMSGEDENTKQGAGVTNQFCYGINVTLQIETGREEKS
ENTPQENGFDHEEKTQHMEVGLITPRMHE*

DNA
ATGTCTCAGCCAAACAATAACAACGGTGATGATGATAAAAGATACAAGAAGATCTTCGTTGGAGGTTTAGCATGGAGCGT
AACAACAGATGTTTTGAGAAGTTTCTTCCAAGAAAAGTGTGGAGAGGTTCTCGAGGCTAATGTTGTCAGCGAGACTCTCC
CTGATGGTAACTTAAAATCAAAAGGCTATGGTTTTGTTACTTTTAGGGATGTTGCAGCTGCAACTAGAGCTTGTCAACCT
CCCTATCCGGATATTGAGGGAAGAAGAACCAACATCAATCTCGCTTACGTTAATGCAAAGAATAACCCTAACCACTCTAA
CCAAACCGGTTTACTGCAACAGGCTGGACCATCGCATCAATATCAACACGGTCCGTTTAATCAGATGGCATGGCATCAAT
ACCAGAACGGTTGGTTTAATCAGGTGGCTTGGCAACAGTATCCGCAATTTTGTACAAATCCACAGTTTCCTCTAGTCTAC
TGGGATTCATATCGTGGAGCATATATTCAAATTCCACACCATCCTTGCTCCTCCAACATGAATTGGCATCAGACCCACAG
TGTACGACCTCCCGGTATGTCTCAGCCGCCTACAGAACCAAGATTTGAAGAGCTCCCTGCTGATACCAATCAAGAAGCTG
TCTCCACTGCAGATGGTGTGAGCAATGACAACAAAGAAGAGGTCGATACAGAAACAGACAATGGTGCTGATCAGCAAAAT
GGAAAGGCTCAAGAAGGAGAGATCAGTGGACAAAACAATGGCATCAAGCAAGATGTTAAGGATCAAGAAGGAGAGATCAA
TGGACAAGACAACGGCATCAAGCAAGATGTTAAGGATGAAGAGGGAAAGATCATGAGTGGAGAAGATGAAAACACCAAGC
AGGGTGCAGGTGTAACAAATCAGTTTTGTTATGGGATCAATGTTACACTCCAAATCGAGACAGGCCGTGAAGAAAAATCT
GAAAACACACCACAAGAAAACGGTTTTGATCATGAAGAGAAGACGCAGCATATGGAAGTTGGACTGATCACACCAAGAAT
GCATGAGTAA