Details for Kale Locus Bo5g142960

Position : C5 ( 5`- 44151194 .. 44154134 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g142960

Protein [Map View]
MLARAPPPSVTFPARNKVCNRREIVRLFRNGGGVITRAGFTRRPLEASCSNEVVSDSTDDGFIVIKAEHRETELYPPPPP
PPSIPPSESSRRNGSRSRGVTASFGRLKAQKVKALVGKVTQKKQQVSRNEEEEDEDDDIFEDEEFGGSSILDLMRKKLAM
KAIPSSGKSSEVKRFSRVRESRELRDTDRSQTNERDSNGYAAANSRGRGDRPSNAKNLDTFKGSDRAAGEFANPRKFSDN
ERAGSRSSYSKDSSAANSRGREDRRFVNKESDTYQRRDRATTDEFSDARYFNDNERAGSHYSYSRGGAGNSRGWGDRRSV
VYARDMEDWRERGNKTKSTRETGFFSRKSFAEVGCSEGMMKALKENNFDRPAHIQALAFAPVVDGKSCIIADQSGSGKTL
AYLVPVIQRLREEELQGLSKSSSGCPRVIVLVPTAELASQVLANCRLISKSGVPFRSMVVTGGFKQRTQLENLEQGVDVL
IATPGRFTYLMNEGILGLSNLRCAILDEVDILFGDEEFESALQNLISSSPVTAQYLFVTATLPLEIYNKLVEVFPDCEVV
MGPRVHRVSNALEEVLVDCSGDDYAEKTPETAFQNKKAALLQIIEENPVAKTIIFCNKIETCRKVENIFKRLDRNERQLH
VLPFHAALAQGARLTNMEEFTSSHPEDHSLFLVCTDRASRGIDFSGVDHVVLFDFPRDPSEYVRRVGRTARGARGEGKAF
VFVVGKQVTLARRIIERNQKGHPVHDVPNAYEFTT*

DNA
ATGTTGGCGAGAGCTCCACCTCCGTCAGTTACTTTTCCGGCGAGGAATAAAGTTTGTAATCGGAGAGAGATCGTGCGGCT
GTTTCGCAACGGAGGAGGAGTGATAACGAGAGCCGGTTTCACTCGTCGGCCACTGGAGGCTTCATGCTCGAATGAGGTCG
TTAGCGACTCCACCGACGATGGATTCATCGTAATCAAAGCGGAACACCGCGAGACGGAGCTCTATCCTCCGCCTCCTCCT
CCGCCTTCGATTCCGCCGTCAGAATCTTCGAGAAGAAATGGTTCGCGTTCGAGAGGAGTAACCGCGAGTTTCGGGAGGCT
AAAGGCGCAGAAAGTGAAGGCTCTCGTTGGTAAGGTAACGCAGAAGAAGCAGCAAGTGAGTCGTAATGAGGAAGAAGAAG
ACGAGGATGATGATATATTTGAGGATGAAGAGTTTGGTGGATCATCAATTCTTGATTTGATGAGGAAGAAGTTGGCTATG
AAGGCTATTCCTAGTTCAGGAAAATCTTCAGAGGTGAAAAGATTCAGCAGAGTGCGGGAATCTAGAGAGCTAAGAGATAC
AGATAGATCTCAGACTAATGAGAGAGATTCAAACGGTTATGCTGCTGCTAACTCCAGGGGTAGAGGAGATAGGCCTTCGA
ATGCGAAAAATTTAGATACATTCAAGGGGAGTGACAGAGCTGCTGGTGAGTTTGCAAACCCTCGGAAGTTTAGTGATAAC
GAGAGAGCAGGATCAAGGAGTTCATATTCAAAAGATTCCTCTGCTGCTAATTCTAGGGGTAGAGAAGATAGGCGTTTTGT
TAACAAAGAGTCAGATACATATCAGAGACGTGATAGAGCTACTACGGATGAGTTTTCAGATGCTCGGTATTTCAATGATA
ATGAGAGAGCAGGGTCGCATTATTCATATTCAAGAGGCGGTGCTGGTAACTCCAGGGGTTGGGGTGATAGGCGTTCTGTT
GTATACGCAAGAGATATGGAGGATTGGAGAGAGAGAGGGAATAAAACCAAGTCTACTAGGGAAACCGGCTTTTTTAGCCG
CAAAAGTTTTGCAGAGGTTGGATGTAGTGAGGGTATGATGAAGGCCTTAAAGGAGAATAATTTTGATCGACCGGCTCATA
TTCAGGCTCTGGCTTTTGCGCCAGTTGTTGATGGAAAGAGTTGTATCATAGCTGACCAAAGTGGATCAGGCAAGACACTG
GCATATCTTGTACCTGTTATCCAGCGTCTCAGGGAAGAGGAACTTCAAGGACTGAGCAAATCGTCTTCTGGTTGTCCTCG
TGTGATTGTTCTGGTACCAACCGCAGAGTTGGCCTCCCAGGTTCTTGCCAACTGTAGATTAATATCAAAGTCTGGGGTCC
CGTTCCGTTCCATGGTAGTGACTGGTGGTTTCAAACAACGAACCCAGCTCGAAAATTTAGAGCAAGGTGTGGACGTTTTG
ATTGCAACACCAGGGCGTTTCACGTACCTTATGAATGAAGGAATTTTGGGGCTGTCAAATTTGAGATGTGCCATATTAGA
TGAGGTGGATATACTCTTTGGCGACGAGGAGTTTGAGTCAGCCCTGCAGAATCTGATCAGTTCCTCCCCTGTGACTGCGC
AGTATCTGTTTGTTACAGCAACCTTGCCCCTCGAGATATACAACAAACTTGTTGAAGTTTTCCCTGATTGTGAAGTTGTA
ATGGGACCTCGCGTGCACCGTGTTAGCAATGCCCTCGAAGAGGTTCTTGTTGACTGCAGTGGAGATGATTATGCAGAGAA
AACTCCTGAGACTGCTTTTCAGAACAAGAAAGCGGCTCTCCTTCAGATTATCGAGGAAAACCCTGTTGCCAAGACTATCA
TCTTCTGCAATAAGATTGAGACATGTAGGAAAGTTGAGAATATATTCAAGCGGCTTGATAGAAACGAAAGGCAGCTGCAC
GTCCTACCGTTTCACGCAGCACTCGCACAAGGGGCAAGGCTTACAAACATGGAAGAATTCACCTCGTCTCATCCCGAAGA
TCATTCACTGTTTCTGGTCTGCACGGATAGAGCTTCTCGTGGGATAGATTTCTCCGGTGTTGATCATGTGGTGCTGTTTG
ATTTTCCGCGTGACCCGAGTGAATACGTAAGACGTGTTGGAAGAACAGCGAGAGGTGCTAGAGGAGAAGGAAAGGCTTTC
GTCTTTGTAGTGGGGAAACAAGTAACGTTGGCAAGGAGGATCATTGAGAGGAACCAGAAGGGTCATCCGGTTCATGATGT
CCCAAACGCTTACGAGTTCACAACCTGA