Details for Kale Locus Bo5g141940

Position : C5 ( 5`- 44113117 .. 44116632 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141940

Protein [Map View]
MPPETSPAKLGRASSSSSSSSSSSSDRASVKIEEIEDGGSSGVVVINGSEVVETKLESAVADNTLAESSGGGSKSFARVW
TMPVEGSSSSDKAESSSSASKPRLDKSKTERQQQKEKVAHILAEDAAKIFDDRLSAGKKLKLLNRIATVKHDGTVEFEVP
ADVIPQAIAVDREEDSKNGVCPDESIDGVDLQYIPPMQIVMLIVGTRGDVQPFVAIAKRLQDYGHRVRLATHANFKEFVL
TAGLEFYPLGGDPKVLAEYMVKNKGFLPSGPSEIPVQRNQMKDIINSLLPACKEPDPDSGISFKADAIIANPPAYGHTHV
AEALRIPIHVFFTMPWTPTSEFPHPLSRVKQPAGYRLSYQIVDSLIWLGIRDMINDLRKKKLKLRPVTYLSGTQSSGSNI
PYGYMWSPHLVPKPKDWGPQIDVVGFCFLDLASNYEPPAELVEWLEAGDKPIYIGFGSLPVQEPETMTEIIVEALQRTKQ
RGIINKGWGGLGNLKEPKDFVYLLDNVPHDWLFPRCKAVVHHGGAGTTAAGLKAACPTTIVPFFGDQPFWGERVHARGVG
PAPIPVDEFSLHKLEDAINFMLDDKVKSSAETLAKAMKDEDGVAGAVKAFFKHLPSMRQNVSDPIPEPSSFLSFRRCFGC
S*

DNA
ATGCCGCCGGAAACATCGCCGGCCAAACTCGGCAGAGCTTCTTCCTCCTCTTCTTCATCGTCATCTTCAAGCTCAGACCG
TGCTTCCGTGAAAATCGAGGAGATTGAAGACGGAGGTAGTAGCGGCGTCGTCGTCATCAATGGCTCTGAAGTAGTGGAGA
CCAAACTAGAGTCTGCTGTCGCCGACAACACTCTGGCTGAGTCTTCAGGTGGTGGGAGTAAAAGCTTTGCTAGAGTATGG
ACAATGCCTGTGGAAGGTTCTTCGAGTAGCGATAAAGCTGAATCATCATCATCAGCGTCAAAGCCTAGGTTAGACAAATC
AAAGACTGAGAGGCAACAGCAGAAAGAGAAAGTCGCTCACATTCTCGCCGAGGACGCCGCTAAGATTTTCGATGACAGAC
TCTCTGCAGGGAAGAAGCTGAAATTGTTGAACCGTATAGCTACGGTGAAACATGATGGGACTGTTGAGTTTGAAGTCCCG
GCAGATGTTATCCCACAGGCTATTGCTGTAGACCGTGAAGAAGATTCCAAAAACGGTGTTTGTCCTGATGAGTCTATTGA
TGGGGTAGATCTTCAGTATATCCCTCCTATGCAGATTGTGATGCTTATCGTTGGAACGCGTGGTGATGTTCAGCCTTTTG
TTGCAATTGCCAAACGCCTTCAGGACTATGGGCATAGAGTTAGACTTGCAACTCATGCGAATTTCAAAGAGTTTGTTTTG
ACTGCTGGTTTGGAGTTTTATCCTTTAGGTGGAGATCCAAAGGTGCTAGCGGAATATATGGTTAAGAACAAGGGGTTTTT
GCCATCAGGCCCTTCAGAGATTCCGGTTCAACGAAACCAAATGAAGGACATCATAAACTCTCTGCTTCCAGCCTGTAAAG
AACCTGATCCAGATTCTGGCATCTCCTTTAAAGCCGACGCAATTATCGCCAATCCTCCAGCATATGGACATACACACGTG
GCAGAAGCACTGAGGATACCTATTCACGTGTTTTTCACCATGCCTTGGACGCCAACCAGTGAGTTTCCACACCCTTTGTC
ACGTGTCAAGCAACCAGCAGGATACAGACTTTCGTATCAAATCGTGGATTCATTGATCTGGCTTGGAATAAGGGACATGA
TAAACGACCTTAGGAAAAAGAAACTGAAGCTAAGGCCCGTTACATATCTAAGTGGAACACAAAGCTCTGGCTCTAATATT
CCATATGGATATATGTGGAGTCCTCATCTAGTCCCAAAGCCCAAAGACTGGGGCCCACAAATAGATGTAGTGGGATTCTG
CTTCCTTGATCTTGCATCAAACTATGAACCTCCTGCAGAACTCGTGGAATGGCTAGAAGCTGGTGACAAACCTATTTACA
TCGGCTTTGGTAGTCTCCCTGTGCAAGAACCAGAGACAATGACTGAAATAATTGTGGAAGCACTTCAAAGAACCAAACAG
AGAGGAATCATCAACAAAGGCTGGGGTGGCCTTGGAAACTTGAAAGAACCGAAGGACTTTGTTTACTTGTTGGATAATGT
CCCTCATGATTGGTTATTCCCAAGATGCAAGGCAGTGGTTCATCATGGAGGTGCTGGAACAACGGCTGCAGGTCTTAAAG
CAGCGTGCCCAACTACAATAGTGCCTTTCTTTGGAGACCAACCTTTCTGGGGAGAAAGAGTGCACGCTAGAGGAGTAGGT
CCTGCACCAATCCCAGTAGACGAATTCTCACTCCATAAGCTTGAAGATGCCATTAATTTCATGCTTGACGATAAGGTGAA
GAGCAGTGCAGAGACACTAGCAAAGGCGATGAAGGACGAGGATGGTGTGGCTGGAGCTGTGAAGGCCTTCTTCAAACATC
TTCCGAGTATGAGACAGAATGTTTCGGATCCTATCCCTGAACCATCGAGCTTCCTATCGTTTAGAAGATGCTTTGGCTGT
TCGTAA