Details for Kale Locus Bo5g141920

Position : C5 ( 5`- 44090763 .. 44093223 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141920

Protein [Map View]
MAKCGKKSKSKRVTLKQKNKVLRKVKEHHKKKAKEAKKLGLNRKPRAEKDPGIPNDWPYKEQEPKALEARRASAVEEIEQ
KKEAHKEKAKKRKLEDEDTKSGDDSTRLVNVRDNSERAFYKELVKVIELSDVILEVLDARDPLGTRCTDMERMVMQAGPN
KHLVLLLNKIDLVPREAAEKWLKYLREEFPAVAFKCSTQEQRSNLGWKSSKASKPSNLLQTSDCLGADTLIKLLKNYSRS
HELKKSITVGIIGLPNVGKSSLINSLKRAHVVNVGATPGLTRSLQEVHLDKNVKLLDCPGVVMLKSSANDASIALRNCKR
IEKLEDPVSPVKEILKLCSPQLLVTLYKIQSFEAVDDFLYKVATVRGKLKKGGLVDIEAAARIVLHDWNEGKIPFYTMPP
KRDQGEHAESKIVTELAKEFNIDEVYSGESSFIGSLKTVSDFNPVEIPSSGPLSFDETMIEDGSKTQTKEEEAGLDNDGD
ESMGGEEDEEETGKLKSEASRQNRKLYAAESMLNTKRQKAEKKQRKKAKKAAGGEDLMDGDYDFKEDYGKKNKDTDMDEG
DGFQIDAKIPMAALLDLPEE*

DNA
ATGGCGAAGTGTGGTAAAAAGAGCAAGAGTAAGAGGGTGACCTTGAAGCAGAAGAACAAGGTCCTTAGAAAGGTGAAGGA
GCACCACAAGAAGAAGGCAAAGGAGGCTAAGAAGCTCGGCCTTAACCGCAAGCCGAGAGCAGAGAAGGACCCAGGTATCC
CCAATGACTGGCCTTACAAGGAACAGGAGCCTAAGGCCTTAGAAGCTCGACGTGCCAGTGCTGTGGAGGAGATTGAACAG
AAGAAAGAGGCCCACAAAGAAAAGGCTAAAAAGAGGAAGCTTGAGGATGAGGATACCAAGAGTGGAGATGACTCAACTAG
ACTTGTCAATGTTCGAGATAACTCGGAGAGGGCTTTCTACAAGGAGCTTGTGAAAGTCATTGAACTATCCGACGTCATTC
TCGAGGTTCTTGATGCTCGTGATCCCCTTGGCACGCGTTGTACCGACATGGAGAGGATGGTGATGCAAGCCGGTCCCAAT
AAGCACCTCGTCTTGCTTCTCAACAAGATTGATCTTGTTCCTCGAGAGGCTGCTGAGAAATGGCTCAAGTACCTTAGGGA
AGAGTTTCCAGCTGTTGCCTTCAAATGTAGCACCCAGGAACAGAGATCAAACTTGGGTTGGAAGTCTTCTAAGGCGTCGA
AACCAAGTAATCTTTTGCAGACGAGTGATTGTCTTGGAGCAGACACTCTTATCAAACTGCTGAAGAACTACTCGAGAAGT
CATGAGTTGAAAAAATCTATCACAGTTGGTATTATCGGACTTCCCAATGTGGGGAAGAGTAGTCTTATCAACAGTTTGAA
GAGAGCTCACGTTGTCAACGTCGGCGCCACTCCTGGACTGACTAGGTCTCTGCAAGAGGTTCACCTGGACAAAAACGTGA
AGCTGCTGGATTGTCCTGGAGTCGTGATGCTCAAATCTTCAGCGAATGATGCTTCTATAGCTCTCCGCAACTGTAAAAGA
ATCGAGAAGCTGGAAGATCCGGTTAGTCCAGTGAAGGAGATTCTCAAGCTTTGTTCACCACAATTGCTGGTGACTCTGTA
CAAGATCCAGAGCTTCGAGGCAGTTGATGACTTTCTTTATAAAGTGGCTACCGTTAGGGGGAAGCTTAAGAAGGGTGGTC
TTGTGGATATCGAAGCTGCTGCGAGGATTGTGTTGCATGACTGGAATGAAGGTAAGATTCCGTTCTATACAATGCCGCCA
AAGAGGGACCAAGGTGAACACGCAGAGTCAAAGATTGTGACCGAGTTGGCTAAGGAGTTCAACATCGATGAGGTTTACAG
TGGTGAGTCTTCTTTCATTGGGAGTTTGAAGACTGTTAGCGACTTCAACCCTGTTGAGATTCCTTCCAGTGGTCCTCTCA
GTTTCGATGAAACTATGATCGAGGATGGGTCTAAGACTCAGACCAAAGAAGAAGAGGCTGGTCTTGACAATGATGGTGAT
GAGTCTATGGGAGGGGAAGAGGATGAAGAAGAAACAGGAAAGTTGAAGTCCGAGGCGAGCAGGCAGAACAGGAAGCTATA
CGCAGCTGAGAGCATGCTTAACACAAAGAGGCAGAAAGCAGAGAAGAAGCAGAGGAAGAAGGCGAAGAAAGCAGCAGGTG
GTGAGGATCTTATGGACGGAGATTATGATTTCAAAGAAGATTATGGGAAGAAGAACAAAGATACAGACATGGATGAAGGA
GACGGGTTCCAAATCGATGCTAAAATACCAATGGCTGCACTTCTTGATTTGCCTGAAGAATGA