Details for Kale Locus Bo5g141910

Position : C5 ( 5`- 44085283 .. 44089362 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141910

Protein [Map View]
MSSSISLNLKKISWLSSRIVSGNIIHCGFRRPVAIGGDRNTLVGTRGFASVKRVSPHADLLSYVRASLDKLEGPSHHWLN
RDTENKQLFKDKGTYVVLVGDLLNGDPSCFFEKLKLLQQRSPGVCFMGIHFSDQARITDDRTALAELIVKEYLTFPVLLS
EKEFPKSSGEEVRYFVFRDFKNPLIYQDKDLDIASVAKALDSLSQDTEKSKSVKLFTNTWSKQADAIKEPHFSSFLQDLF
LYFPGCISADEAGDCLFLSDSNHHRIIISTSTGEILDSIGCFPGFEDGEFESAKMLRPAATLYDEEDDCLYIVDSENHAI
RRANIKTRVLETVYPKVIKKSVGLWSWVMEKIGFEKDEETTVGADAKSEESDAPSLMFPWHILKRDDDSLVVINKSFSKL
WIINLASGEIEEVVEGFQGIMEIYGELITEKLSLLKHLPSTRLQQQTKAITSCKEQPSAALLSSFSEFGDDIVMTDTAGQ
RVLKLNRESGACSSIQFSNIGILGLPYWLSIPLERVFNLASGVQEAHISHIHQLRLLPGKTSIRLSIQIPQCTELVEPLQ
ESCIWRQARGSITEVSNAGSAVEPSEKVGVSQQWYDELDNLAKEIVNPELAEEDEEEQEEDISEISEDDGRIHIDCSVNT
SPGTSELIVYAALHLRLAKNEETEGASQEELARRIADVLNPARNMTTMDEDLFVKVLLKSKREVRDIVFLKPVHVRIKFD
TLDHPKADNSRDIILTDSSAQIDVSL*

DNA
ATGTCTAGCAGCATAAGCCTCAATTTGAAGAAAATTTCGTGGCTTTCTTCTCGGATCGTCTCAGGAAATATTATTCACTG
TGGGTTTCGGCGACCCGTCGCTATCGGTGGAGACAGAAACACATTGGTCGGAACTCGCGGATTTGCGTCAGTGAAACGAG
TGTCTCCACATGCTGATTTGCTCTCTTATGTTAGAGCTTCACTTGATAAGCTTGAAGGTCCTTCCCATCATTGGTTGAAT
CGTGACACTGAGAATAAACAGCTTTTCAAGGACAAAGGGACTTACGTAGTTCTTGTTGGCGATTTGCTTAATGGTGATCC
GAGTTGTTTCTTTGAGAAACTCAAGTTGCTTCAGCAGAGGTCTCCTGGAGTCTGTTTCATGGGCATTCACTTTAGTGATC
AAGCTAGAATCACCGATGATCGAACTGCTTTAGCTGAGTTGATTGTTAAGGAATATCTTACTTTTCCTGTACTGCTTTCT
GAGAAAGAGTTTCCTAAGTCAAGTGGAGAAGAAGTACGCTACTTCGTGTTTAGAGATTTTAAGAACCCTTTAATCTACCA
AGACAAGGATCTGGATATTGCTTCTGTAGCTAAAGCTCTTGACAGCCTCAGTCAAGATACTGAGAAATCAAAGTCCGTCA
AACTTTTCACCAACACTTGGTCAAAACAGGCTGATGCTATCAAGGAACCACACTTCTCTTCTTTCTTGCAAGATTTGTTT
CTTTACTTTCCAGGTTGTATCTCTGCAGACGAAGCCGGAGATTGCCTGTTTCTTTCTGATAGCAACCATCATCGTATTAT
CATATCCACTAGTACTGGGGAGATTCTAGACAGTATTGGTTGTTTCCCAGGTTTTGAGGATGGAGAATTCGAATCAGCAA
AGATGCTACGTCCTGCAGCGACCCTTTATGACGAAGAAGATGATTGCCTTTACATTGTAGATTCTGAGAATCATGCCATT
AGAAGAGCAAATATAAAGACGCGGGTCCTGGAAACGGTATATCCAAAGGTTATCAAGAAGAGTGTTGGCTTATGGTCTTG
GGTAATGGAGAAAATAGGTTTTGAAAAAGATGAAGAAACAACAGTGGGTGCTGATGCTAAATCAGAAGAGTCTGATGCTC
CCTCCCTCATGTTTCCATGGCATATACTTAAACGTGATGATGATAGTCTTGTAGTCATTAACAAAAGCTTTTCAAAGTTG
TGGATAATAAATTTAGCTTCTGGAGAGATCGAAGAAGTTGTGGAAGGGTTCCAGGGGATAATGGAGATCTATGGGGAATT
GATCACGGAGAAGCTATCGCTATTGAAACATTTGCCTTCTACTCGGTTGCAACAGCAAACTAAGGCTATCACCTCATGCA
AGGAGCAGCCAAGTGCGGCCCTTTTGTCTTCTTTCTCTGAATTTGGAGACGACATTGTCATGACAGATACAGCTGGCCAG
AGGGTGTTGAAGCTAAATAGAGAATCTGGAGCATGCTCTAGCATACAGTTTTCAAACATTGGGATCCTTGGGTTACCGTA
TTGGTTGTCCATTCCACTGGAGAGAGTTTTCAATCTAGCTAGCGGAGTACAGGAAGCACACATCAGCCATATTCATCAAC
TCCGGTTATTACCAGGTAAAACTAGCATACGGTTGAGCATACAGATCCCTCAATGCACAGAGCTTGTTGAACCGTTGCAA
GAAAGCTGCATATGGCGACAGGCAAGAGGCTCAATCACTGAAGTCTCAAATGCTGGAAGTGCAGTGGAACCTTCTGAAAA
GGTTGGAGTCTCACAACAATGGTACGATGAATTAGACAACCTCGCCAAAGAAATAGTCAACCCTGAATTAGCTGAGGAAG
ATGAAGAAGAGCAAGAAGAAGATATCTCTGAGATCAGTGAAGATGATGGACGGATACACATCGATTGCTCTGTCAATACA
AGTCCTGGCACAAGCGAGCTTATTGTTTATGCAGCTTTGCATCTAAGACTGGCGAAGAACGAAGAGACAGAAGGTGCGAG
CCAGGAAGAGCTGGCGAGAAGAATAGCAGACGTTTTAAATCCAGCAAGGAACATGACGACTATGGATGAAGATTTGTTTG
TGAAAGTGTTGTTGAAGTCAAAGAGAGAAGTGAGAGACATTGTCTTCTTGAAGCCGGTGCATGTGCGTATAAAGTTTGAC
ACGTTGGATCACCCAAAAGCTGATAACTCGAGAGACATTATCTTGACGGATTCTTCGGCTCAGATCGATGTCTCTCTTTG
A