Details for Kale Locus Bo5g141880

Position : C5 ( 5`- 44074270 .. 44074987 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141880

Protein [Map View]
MSGTIIVSLGDSESNSTATVKNPLLGDVLSLISAVFYAVYITLIRKNLPDDGEGSGRFSMAQLLGFLGLFNFFIFLPAAL
ILNFTRRERFNALTSKQLGLVVGKGLLDNVLSDYLWAKAVLLTTTTVASAGLTIQVPLAAIVDSLSGNKPSFTDFIGAVA
VMGGFAGINIPLEMFYRSKETSIIELEPGTSFTDPPQVVSDSIGVDSSETLVS*

DNA
ATGTCTGGGACCATTATTGTGAGTCTGGGAGACTCGGAATCGAACTCAACTGCAACGGTTAAGAACCCTCTTCTTGGAGA
TGTTCTTTCTCTGATCTCGGCGGTGTTTTACGCTGTCTACATCACTCTTATACGCAAAAATCTTCCTGATGATGGTGAAG
GTAGCGGCCGGTTTAGTATGGCTCAGCTTCTTGGGTTCCTAGGTCTCTTCAACTTCTTTATCTTCCTACCTGCTGCTCTA
ATACTCAACTTCACAAGGAGAGAGCGGTTCAACGCACTGACCTCGAAACAGTTGGGTCTGGTGGTTGGCAAAGGTTTGTT
AGATAATGTACTCAGTGACTACCTTTGGGCAAAGGCTGTGCTTTTGACAACGACCACGGTGGCATCGGCTGGGCTGACCA
TTCAGGTTCCATTGGCAGCGATTGTAGACAGCTTATCGGGGAACAAACCAAGCTTCACCGACTTCATTGGCGCTGTAGCT
GTAATGGGTGGCTTTGCAGGCATCAATATTCCACTAGAGATGTTTTACAGATCCAAAGAGACATCTATTATTGAGTTAGA
ACCTGGAACATCGTTCACAGATCCTCCTCAGGTTGTGTCGGATAGCATAGGAGTAGATTCTTCAGAGACCCTAGTGTCCT
AA