Details for Kale Locus Bo5g141870

Position : C5 ( 5`- 44072859 .. 44074089 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141870

Protein [Map View]
MAEEAHKVTLNVYDLSRGLARQLSASFLGKVIEGVWHTGIVVYGNEYFFGGGIQHLPAGTTPYGAPLRTVELGETHVPKD
VFEMYLEEIRPRYTAESYNLLAHNCNNFSNEVAQFLVGKGIPDYILQLPNEVMNSPMGGLIMPMIQNLETTLRAGAVPNA
PQFRPQTQPLGAFSKDEGPKLPNKPEKASKSEDVKTSAPTEKVSPVSQASSSKEKVKEDPLGDARTKIQEEITREFAALM
AEGTLRASEAAAMATKRVMQKYGHLNVSA*

DNA
ATGGCTGAGGAAGCGCACAAGGTTACGTTGAATGTCTATGATCTAAGCAGAGGCTTAGCACGTCAGCTCTCTGCTTCATT
TCTGGGAAAGGTTATCGAAGGTGTCTGGCATACGGGAATAGTTGTGTATGGGAATGAATACTTTTTCGGAGGAGGAATCC
AGCATTTGCCTGCTGGAACCACCCCATATGGAGCACCGCTGCGAACCGTAGAGCTGGGTGAGACACATGTTCCTAAAGAC
GTGTTCGAGATGTACTTGGAGGAGATCAGACCACGTTACACTGCTGAATCCTACAATCTGCTTGCTCATAACTGCAACAA
CTTCAGCAACGAGGTAGCTCAGTTTCTGGTTGGTAAAGGGATTCCAGACTACATTCTTCAGCTTCCCAATGAGGTCATGA
ACAGCCCCATGGGTGGTCTTATAATGCCTATGATACAAAACCTGGAGACGACTCTAAGAGCCGGCGCTGTTCCTAACGCT
CCCCAGTTTAGGCCTCAGACACAACCTCTTGGAGCTTTTAGCAAGGATGAAGGTCCAAAACTACCCAACAAACCTGAGAA
AGCGTCCAAGTCTGAGGATGTCAAAACCTCAGCTCCAACTGAAAAGGTGTCACCGGTTTCTCAAGCTTCTTCTAGTAAGG
AGAAGGTGAAGGAGGATCCGTTGGGTGATGCTAGGACCAAGATTCAGGAAGAGATCACCCGTGAGTTTGCAGCTCTCATG
GCGGAAGGCACACTGAGAGCAAGTGAAGCAGCCGCCATGGCGACAAAAAGAGTGATGCAAAAGTATGGACATCTCAATGT
ATCTGCCTAG