Details for Kale Locus Bo5g141840

Position : C5 ( 5`- 44060956 .. 44061594 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141840

Protein [Map View]
MSENPPGSSGRGMFTRGPSMRVGSSKNPDDFADVSIPGDGPPSRSFKPQFSRHDSVRDHGDGEDDKILRHPVVKFEDERQ
MSAREAVAAQEAAEAEEDDEEDEDDSEEETEEKSSAPKQTMSLMDLLEETDRQMGLTGARYAMDEEDEEDEDEEEEEEEG
ELSCCVCHVHIKGATFAPCGHTFCKLCSKELMAQKGHCPVCISFVLEFLEIF*

DNA
ATGTCGGAAAATCCACCTGGCTCTTCAGGACGCGGGATGTTCACGCGCGGACCTTCAATGCGGGTCGGGTCGAGTAAAAA
CCCGGACGATTTTGCTGACGTAAGCATCCCTGGAGACGGACCGCCGTCGAGGAGCTTCAAGCCGCAATTTTCACGCCACG
ATTCCGTTAGGGATCACGGTGACGGCGAAGACGATAAAATCCTCCGTCATCCGGTGGTTAAGTTCGAGGATGAGAGGCAG
ATGTCGGCGAGAGAAGCCGTCGCGGCGCAGGAAGCTGCGGAAGCAGAGGAAGACGACGAAGAGGATGAAGATGATTCAGA
AGAAGAAACAGAGGAGAAATCATCTGCGCCGAAGCAGACAATGTCGCTGATGGATCTGTTGGAAGAGACGGATCGGCAAA
TGGGGTTAACGGGAGCAAGATACGCCATGGACGAAGAAGACGAAGAAGATGAAGACGAGGAAGAAGAAGAAGAAGAAGGA
GAGCTGAGCTGCTGCGTTTGTCATGTACACATCAAAGGCGCGACCTTTGCACCGTGCGGTCACACGTTTTGTAAGCTCTG
TTCTAAAGAGCTTATGGCTCAGAAAGGCCATTGTCCCGTTTGCATCAGCTTCGTCCTCGAGTTCCTCGAGATCTTCTAG