Details for Kale Locus Bo5g141820

Position : C5 ( 5`- 44052131 .. 44054848 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141820

Protein [Map View]
MARTVLTWWIPLLILQSFLLAIAFGSNEVEEEFSESLLLKPLPDRKVLAHFHFENRAPPSNSHGRHHHLFPKAISQLVQK
FRVKEMELSFTQGPWNHEHWGGSDTLSSMNAKPVGVELWAVFDVPRSEVDTSWKNLTHALSGLFCASINFLESSTSYAAP
TWGFGRSSDKLRYGSLPREAVCTENLTPWLKLLPCRDKDGISALMNRPSVYRGFYHSQRLHLSMIDSGMLLEQSLTVVLQ
PDTVYDGKDLQPSWSLSSLFGRKVVGKCVLAKSSNVYLQMEGLAHPEAHTLLKNEEFELSIKPDRTLRETSSVLFIFDID
KSSDSEPFDLSLTWKLPSKWSCQQAPLHASRFLMGSGNERGAIAILLKATESQDKLSGKDITNGGRCRIKANVFQIFPWY
VKVYYHTLQIFVDQQQNTSSEVLKKINVSPSADKMSSGMMEMMLELPCEVKSVAISIEYDKGFLHIDEYPPDANQGFDIP
SALISFPDHHASLDFKEELSTLPLLSKFKDKSLVRSYTEVLLVPLTTPDFSMPYNVITITCTVFALYFGSLLNALRRRIG
EEERFLKSKGKKTGGLKQLLSRFTAKIRGRPVESPSSEPTAAAQSSVLSSKLLFKIILVAGVAAAWQYFSTDK*

DNA
ATGGCTAGAACCGTTCTCACCTGGTGGATCCCTTTGTTAATTCTGCAATCGTTTCTGCTCGCGATAGCTTTCGGATCGAA
CGAAGTAGAAGAAGAGTTCAGCGAGTCGTTGCTGTTGAAGCCTCTGCCCGATCGGAAAGTCTTGGCTCATTTCCATTTCG
AGAATCGAGCTCCTCCGTCGAACTCCCATGGCCGCCACCACCATCTCTTCCCCAAAGCTATCTCTCAGCTGGTTCAGAAG
TTTCGAGTCAAGGAGATGGAGCTATCTTTCACTCAGGGACCTTGGAACCACGAACACTGGGGAGGATCTGACACTCTTTC
AAGTATGAACGCGAAGCCTGTTGGTGTCGAGCTTTGGGCTGTGTTTGACGTTCCTCGCTCTGAGGTTGATACTTCTTGGA
AGAACTTAACACACGCGCTCTCAGGGCTTTTCTGTGCTTCCATCAACTTTCTCGAATCTTCCACTTCGTATGCTGCTCCT
ACGTGGGGGTTTGGGAGAAGCTCGGATAAGCTTAGGTATGGTTCATTGCCGCGTGAAGCTGTTTGTACTGAGAATTTGAC
GCCGTGGCTGAAGCTGCTCCCGTGTAGAGACAAGGATGGGATCTCTGCGTTGATGAATAGGCCGTCTGTTTACAGAGGGT
TTTATCATTCTCAGAGATTGCATTTATCTATGATTGACTCTGGCATGTTGCTTGAGCAGAGTCTTACTGTTGTTCTTCAG
CCTGACACTGTTTATGATGGAAAAGATCTACAGCCAAGTTGGTCTCTTAGCTCACTCTTTGGGAGAAAAGTTGTCGGAAA
ATGTGTTCTTGCAAAGTCAAGTAATGTGTATCTTCAAATGGAGGGTCTTGCGCATCCAGAAGCTCACACACTCTTGAAGA
ATGAAGAATTCGAATTGTCCATAAAGCCAGACAGGACTCTTAGAGAAACCAGCAGCGTTCTTTTTATCTTCGATATTGAC
AAATCCAGTGACAGTGAGCCATTTGATCTTAGCCTGACTTGGAAGCTTCCTTCAAAGTGGTCATGCCAACAAGCACCATT
ACACGCTTCTCGGTTCTTGATGGGAAGCGGAAACGAAAGGGGTGCAATAGCCATCTTGTTAAAAGCCACAGAATCACAGG
ATAAGTTATCCGGAAAAGATATCACTAATGGCGGCCGCTGTAGAATAAAAGCTAACGTTTTCCAGATTTTCCCGTGGTAT
GTTAAGGTTTATTATCACACACTACAAATCTTTGTGGACCAACAACAGAATACAAGCAGCGAGGTCTTAAAGAAGATCAA
TGTCTCACCATCTGCGGATAAGATGTCATCTGGCATGATGGAGATGATGCTGGAACTACCCTGTGAAGTGAAATCTGTAG
CCATATCCATAGAGTATGATAAGGGTTTTCTACATATAGATGAATATCCTCCTGATGCTAACCAAGGATTCGACATTCCA
TCGGCTTTGATAAGCTTTCCTGATCATCATGCAAGTTTGGATTTCAAAGAAGAACTCAGCACATTGCCCCTGTTATCAAA
ATTTAAGGACAAGTCATTAGTGCGCTCTTACACAGAAGTATTGCTCGTACCTTTGACAACCCCTGATTTTAGCATGCCTT
ACAACGTCATCACGATCACGTGCACTGTTTTCGCATTGTACTTCGGATCATTGCTCAATGCTCTCCGTAGACGAATAGGT
GAAGAAGAAAGGTTTCTCAAAAGCAAAGGAAAGAAAACAGGTGGGCTTAAGCAGTTGTTATCAAGATTCACAGCCAAGAT
CAGAGGAAGACCAGTTGAATCACCATCATCAGAGCCGACCGCAGCAGCTCAATCTTCGGTTTTGTCTAGTAAACTTCTCT
TCAAGATCATTTTGGTTGCAGGAGTTGCTGCAGCATGGCAATATTTTTCCACGGATAAGTAG