Details for Kale Locus Bo5g141780

Position : C5 ( 5`- 44020126 .. 44021245 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141780

Protein [Map View]
MANRAHVPKFGDWNNQSQPFTAVFDNARTNKRADLYESLENSDIKTQAKPPPQQPAPIIPKPVRAPPPTETNKVRAPPAD
QLYGARGGLYGGYGGGGGSGNQRQPQAPPRPPQTQPKPNVRGGNNGRGGTTIPPFPGSVGSGDQNMSYTHIFDQVKEERR
DARSNGGSVGNTPSRPINDQWSHESTAPGSFKFCCFSWGRKGSSY*

DNA
ATGGCAAACCGCGCGCACGTTCCAAAGTTTGGGGACTGGAACAACCAATCTCAACCATTCACAGCCGTCTTCGACAACGC
TAGGACGAACAAACGAGCTGACTTGTACGAGTCTCTAGAGAACTCTGACATCAAAACTCAAGCAAAACCTCCTCCACAAC
AACCTGCTCCTATAATTCCAAAACCGGTTAGAGCGCCACCACCAACCGAGACAAACAAAGTCAGAGCTCCTCCTGCCGAT
CAGCTCTACGGAGCTAGAGGCGGACTATACGGAGGTTATGGAGGTGGAGGCGGATCTGGAAACCAGCGGCAGCCTCAAGC
TCCTCCTCGGCCACCACAGACACAGCCTAAACCAAATGTTAGAGGCGGCAACAACGGAAGGGGAGGGACGACGATTCCAC
CATTTCCAGGATCAGTGGGCTCAGGGGATCAGAACATGAGTTACACACACATTTTCGACCAAGTCAAGGAAGAGAGGCGA
GATGCCAGATCCAACGGTGGATCAGTAGGTAATACTCCATCTCGCCCCATCAACGATCAATGGTCACATGAATCTACTGC
TCCAGGCTCCTTCAAGTTTTGTTGCTTCTCATGGGGACGAAAGGGAAGCAGCTATTGA