Details for Kale Locus Bo5g141770

Position : C5 ( 5`- 44018354 .. 44019149 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141770

Protein [Map View]
MSSRSERVVTRSSRRSQQVNNVNETQSEQPRAGQTPIVSGPPTIDVDAIEDDDDVVESTASAFDRAKRHKSGGSQRGGPL
LVDVESGGTTRLSKNRTKRQSDQANVGLNNPRKSKTVAPPVEEPKFNCPICMCPFTEEVSTKCGHIFCKKCIKLAVSVQA
KCPTCRKRVIAKDLIRVFLPTTR*

DNA
ATGAGTTCTCGGAGTGAGAGGGTAGTTACCAGAAGCTCAAGAAGGTCACAACAGGTGAACAATGTGAATGAGACACAAAG
TGAGCAACCAAGAGCTGGACAAACTCCAATTGTGTCTGGTCCACCGACAATTGATGTTGATGCCATTGAGGATGATGATG
ATGTTGTTGAGTCAACTGCTTCTGCTTTTGATCGAGCTAAAAGACACAAGTCCGGAGGCTCACAGCGAGGAGGACCCTTA
CTAGTTGATGTAGAGTCAGGTGGTACCACTAGACTAAGCAAGAACCGCACAAAGCGTCAGTCTGATCAAGCTAATGTTGG
GCTTAACAATCCGAGGAAGTCTAAGACCGTAGCTCCTCCTGTTGAGGAACCAAAGTTCAACTGCCCAATTTGCATGTGTC
CATTCACCGAGGAGGTCTCAACAAAGTGTGGTCATATCTTCTGCAAAAAATGCATAAAGCTTGCGGTGTCAGTTCAAGCT
AAATGCCCTACGTGTAGAAAAAGGGTCATTGCTAAAGACCTCATTCGAGTCTTCCTTCCAACCACCAGATGA