Details for Kale Locus Bo5g141760

Position : C5 ( 5`- 44015193 .. 44017673 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141760

Protein [Map View]
KKLISLLISRFPRLVFLSRTCVFEFPPLLFFWSFIKKTKVDVFTALNRDSHIHVLCPHNPIITTISHFSPKISRSDTNPS
QSRICRIKSHRERMGVILDSWCFCKGVSKSEKMKGSIFSGKAPAMARISVSGPNGTVTSGTGFLIHRNLLLTTHLNLPSV
SATETAEVRLQNGVAAALFPHRFFITSSVIDLTIVGVDLVDGGDSNSQSQTQQQPHYLKTCSKPNLELGSVVYLLGYAAQ
NELKIGEGKLVVATDSLIKLSTDEMIWSPGSAGFDVQGNLAFMICDPRKLATSPASTSTSSSSSLKKDNNKTLMMQFGIP
MPVICDWLNQHWEGSLDEHTSKPKLPLIRLMSSGQKSERSCASFTMRPVFKPTDSAADVGTPSSSNARDQTEGDKEEKEE
ETSRKLTTSTTHAQGIPTPEIYESPKLTSSPLRKDSGGGQVHLLDINFPPRVPKVPTYLPQLNYPPQSSNHMVEEAEIAS
EGSDAQIASTGSVNGALSEVISSSPPPEAAHYVYHHNHGYSSEEETTMYSAETAESRNYPTPPAKSCVGRSQSCVSSSGR
WGTPQKSLSGRRAMLEKQRSFVHGNNKMHSQGGATSQRSNDYYSPTVSSIMKKRNNSSEKPVFKPVPRPRAASPSSQRWM
F*

DNA
AAGAAGCTCATCTCTTTACTCATTTCACGATTCCCCCGTCTCGTGTTTCTCTCACGCACTTGTGTCTTTGAGTTTCCTCC
TCTTCTCTTCTTTTGGTCTTTCATCAAAAAGACCAAAGTTGATGTTTTTACAGCCCTAAACAGAGACAGCCACATACATG
TGTTATGTCCCCATAATCCCATTATTACCACCATTTCACACTTCTCTCCTAAAATTTCCAGATCCGACACAAACCCATCT
CAGAGCAGAATCTGCAGAATCAAGAGCCATAGAGAGAGAATGGGAGTGATATTGGACTCTTGGTGCTTCTGCAAAGGAGT
AAGCAAAAGCGAGAAGATGAAAGGTTCGATTTTCTCCGGCAAAGCTCCGGCGATGGCTCGAATCTCCGTCTCCGGACCAA
ACGGTACTGTTACTTCCGGAACAGGATTCCTCATTCATCGGAATCTACTCCTCACCACTCACCTTAATCTCCCTTCCGTC
TCCGCCACCGAAACCGCCGAGGTCCGCCTCCAGAACGGCGTCGCCGCCGCTCTCTTCCCTCACAGGTTTTTCATCACAAG
TTCGGTTATTGATCTGACCATAGTTGGAGTAGACCTTGTTGATGGTGGAGACTCAAACTCTCAGAGTCAAACCCAACAAC
AGCCACATTACCTGAAGACATGTTCTAAACCAAACCTGGAGTTAGGAAGTGTAGTGTACCTTTTAGGCTACGCTGCTCAG
AACGAGCTCAAGATTGGTGAGGGGAAGCTAGTGGTAGCTACAGACAGTCTCATCAAACTATCTACTGATGAAATGATATG
GAGTCCTGGATCAGCTGGGTTTGATGTTCAAGGGAATCTCGCATTCATGATCTGTGATCCGAGGAAGCTAGCTACATCAC
CAGCCTCAACTTCTACATCTTCCTCATCATCATTGAAGAAAGATAACAACAAGACGCTGATGATGCAGTTTGGTATACCA
ATGCCTGTGATCTGTGACTGGCTGAATCAGCATTGGGAAGGTAGTTTGGATGAGCATACGAGTAAACCTAAGCTGCCTCT
CATTAGGTTAATGTCTTCTGGTCAGAAGAGTGAGCGTTCTTGTGCTTCTTTCACCATGCGCCCTGTCTTCAAGCCAACTG
ACTCTGCTGCTGATGTGGGAACACCATCTTCATCTAACGCTAGAGATCAAACTGAGGGAGACAAGGAGGAAAAAGAAGAA
GAAACCTCAAGAAAGTTAACTACTTCTACAACTCATGCACAAGGCATCCCAACCCCTGAGATATATGAATCGCCAAAGCT
AACTTCAAGCCCTTTAAGAAAGGACTCTGGTGGTGGTCAAGTCCATCTTTTGGATATCAACTTCCCGCCACGTGTACCTA
AAGTCCCAACCTATCTTCCTCAGCTCAACTATCCACCACAGAGTAGTAACCATATGGTGGAAGAGGCTGAGATAGCCTCC
GAGGGATCAGACGCGCAGATTGCTTCAACAGGCTCAGTGAACGGCGCTCTCAGCGAGGTCATCTCAAGCTCACCACCACC
AGAAGCAGCTCACTATGTATATCACCACAATCATGGATACAGCAGCGAGGAAGAGACAACAATGTACTCTGCAGAGACAG
CCGAGAGCCGAAACTATCCAACACCTCCAGCGAAAAGCTGTGTTGGAAGGAGCCAAAGCTGTGTGAGCTCCTCCGGCAGA
TGGGGAACGCCTCAGAAGAGTTTGAGCGGTAGAAGAGCAATGCTGGAGAAGCAAAGAAGCTTTGTCCATGGGAATAATAA
GATGCATTCACAAGGAGGAGCAACCTCTCAGAGGAGTAATGACTATTACAGCCCAACGGTGTCATCAATCATGAAGAAAA
GGAATAATAGTTCGGAGAAACCGGTTTTCAAACCGGTGCCTAGACCTAGAGCTGCTAGCCCTTCTTCCCAGAGATGGATG
TTCTGA