Details for Kale Locus Bo5g141710

Position : C5 ( 5`- 43991904 .. 43992352 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141710

Protein [Map View]
MSNGSVKEWCPSVKSSSEQDTEMVSAVVSILKSLGELRSVKGRTPNRKFKEKKLHCELNLPFWSMCEHHLLPFYGVVHIG
YYCAEGYNHKSLMKSIVLFYGFKLQVQERMTRQIAEK*

DNA
ATGAGCAACGGATCTGTGAAAGAGTGGTGCCCGAGCGTTAAAAGCTCGTCTGAACAAGATACTGAAATGGTTTCTGCGGT
TGTTTCGATTCTGAAGTCATTAGGAGAATTAAGATCCGTCAAGGGAAGGACTCCCAACCGTAAGTTCAAAGAGAAGAAGC
TGCACTGTGAACTGAACTTACCCTTTTGGTCAATGTGTGAGCATCATTTGCTTCCTTTCTACGGGGTTGTTCACATTGGC
TACTATTGCGCTGAAGGGTACAACCACAAGTCATTGATGAAGTCTATTGTACTCTTTTATGGGTTCAAGCTTCAAGTGCA
AGAGAGGATGACTCGTCAGATTGCTGAGAAGTAA