Details for Kale Locus Bo5g141650

Position : C5 ( 5`- 43946265 .. 43948545 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141650

Protein [Map View]
MPDVQSTVLEFVNKLRKRKIEGSQATAKCTVELLRSVISQQRVPHSNQASALIDAVKAVGEQLVAANPVELAVGNVVRRV
LHIIREEDLSLATAAMAGLDLLDASDDDGEDDNCKGVGYSAMSAAVAAAAARSTLRPPSLQTLLEGTPESAAVPYTSSSG
ADSESKTADKSSITRKLKHDVIEGVNHLILEISGCHEQIAEQAIEHIHQNEVILTLGSSRTVLEFLCAAKEKKRSFRVFV
AEGAPRYQGHLLAKELVARGLQTTVITDSAVFAMISRVNMVIIGAHAVMANGGVIGPVGVNMAALAAKKHAVPFVVLAGS
HKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCLDFGAGSGSPLLQVVNPTFDYVPPSLVSLFITDTGGHNPSYMYRLIA
DYYSADDLVM*

DNA
ATGCCAGACGTACAATCAACGGTGTTGGAGTTTGTTAACAAGCTCAGAAAACGTAAGATTGAAGGCTCACAGGCTACAGC
CAAATGCACCGTTGAGCTACTCAGGTCAGTGATCTCTCAGCAGCGGGTGCCTCACTCAAACCAAGCTTCAGCTCTTATCG
ATGCTGTGAAAGCCGTCGGTGAACAACTGGTCGCTGCTAATCCTGTTGAGCTTGCGGTGGGGAATGTAGTTAGGCGGGTT
TTGCATATAATAAGGGAGGAGGATCTCTCTTTAGCTACGGCAGCTATGGCTGGTTTGGACTTGCTTGACGCTAGTGATGA
CGATGGTGAAGATGATAACTGCAAAGGAGTTGGGTATTCTGCTATGTCTGCGGCGGTTGCTGCAGCTGCAGCTAGGAGTA
CGCTACGCCCTCCGTCTTTGCAAACGCTTCTCGAGGGGACTCCTGAGTCTGCGGCTGTTCCGTACACTTCTTCGTCCGGT
GCTGATTCCGAAAGCAAAACTGCGGATAAAAGTTCAATAACTCGGAAGCTGAAGCATGATGTTATAGAAGGAGTCAATCA
CCTGATCCTCGAGATTTCCGGTTGTCATGAGCAGATCGCTGAGCAAGCTATAGAGCATATACATCAAAATGAGGTGATTT
TAACCCTGGGTAGCTCAAGAACAGTACTTGAGTTTCTGTGTGCTGCAAAGGAGAAAAAGAGATCATTCCGTGTATTTGTT
GCCGAAGGTGCTCCAAGGTATCAGGGCCATCTCTTAGCGAAAGAATTGGTAGCAAGAGGTCTGCAGACCACTGTGATCAC
CGACTCTGCAGTGTTTGCTATGATATCTCGAGTGAATATGGTTATAATTGGAGCACATGCAGTAATGGCCAATGGTGGGG
TTATAGGACCTGTTGGAGTCAACATGGCTGCCTTGGCAGCAAAAAAGCACGCAGTCCCATTTGTGGTTCTAGCCGGTAGT
CACAAGCTATGTCCACTCTATCCTCACAATCCGGAGGTATTACTAAACGAGCTGAGATCTCCTTCTGAACTGTTGGATTT
TGGTGAATTCTCTGATTGCCTGGACTTCGGAGCAGGTTCCGGGTCTCCCCTTCTTCAAGTTGTCAACCCTACATTCGATT
ACGTCCCACCAAGCCTTGTTAGTCTATTCATAACCGATACGGGAGGACACAACCCATCTTACATGTACCGTCTTATTGCC
GACTACTACTCTGCTGATGATTTGGTGATGTAG