Details for Kale Locus Bo5g141640

Position : C5 ( 5`- 43943291 .. 43945225 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141640

Protein [Map View]
MDTCLSNQAALSFLPSRLRRQSGDGGGGVFSLPSMRKVQYRSMVVVATAGQSRCEPGSSLNAPLELRSAQGRFLRSVLLN
KRQLFHYAAADELKQLADEREAALARMALSSGSDEASLHRRIAHLKERYCKTAVQDIMYMLIFYKYSEIRVPLAPKLSRC
IYNGRLEIWPTKDWELESIHTCDALELIKEHVSAVIGLRVNACVTDNWATTQIQKLHLRNVYDASILYGYFLKSASLRHQ
LECSLSDLHGSGYLKGPVFGSSFTTGTSQISSAKEQLRQYITGFDAETLRRCARPRTEEARNLIEKQSLALFGAEESDET
IVTSYSSLKRLVLEAVAFGTFLWDTELYVEGTYKLKENGNAEEQENRSI*

DNA
ATGGATACTTGTCTCTCAAATCAAGCGGCGCTCTCGTTTCTCCCCTCGCGTCTGAGGAGACAGAGCGGCGACGGAGGCGG
AGGAGTATTTTCCCTCCCTTCGATGAGGAAGGTACAGTATAGATCGATGGTTGTGGTAGCGACTGCGGGGCAGAGCCGGT
GCGAGCCTGGAAGCAGCCTTAACGCGCCGCTTGAGCTGCGATCGGCGCAGGGGAGGTTTCTGAGAAGCGTGCTGCTTAAC
AAGCGGCAGTTGTTTCACTACGCCGCCGCTGATGAGCTCAAGCAGCTGGCTGATGAACGCGAAGCAGCTTTAGCTCGTAT
GGCTCTAAGCTCTGGCTCCGACGAAGCTTCTCTCCACAGAAGGATAGCTCATCTCAAGGAACGTTACTGCAAAACAGCAG
TCCAAGACATAATGTACATGCTAATATTCTACAAATACTCCGAGATACGCGTCCCTCTCGCTCCTAAGCTCTCTAGATGC
ATCTACAACGGAAGACTCGAGATCTGGCCTACAAAAGACTGGGAGCTAGAATCAATCCACACCTGCGACGCCCTCGAGCT
CATCAAAGAACACGTCAGCGCAGTCATCGGGCTACGCGTCAACGCATGCGTGACTGACAACTGGGCAACGACGCAGATAC
AGAAGCTCCATCTCAGAAACGTATACGACGCCTCCATCTTGTACGGTTACTTCTTGAAATCCGCTTCCCTCAGGCACCAG
CTCGAGTGTTCCTTGTCGGATCTCCACGGAAGTGGGTACCTGAAAGGTCCCGTCTTTGGCTCCTCGTTCACGACGGGGAC
TTCGCAGATCTCCTCCGCCAAGGAGCAGCTGAGGCAGTACATCACGGGGTTTGACGCCGAGACGCTGCGGAGGTGCGCGA
GGCCGAGGACGGAGGAAGCTAGGAATCTGATAGAGAAGCAGAGTTTGGCTCTTTTCGGCGCGGAGGAGAGCGATGAGACG
ATTGTGACGTCGTACTCGAGTCTGAAGCGGTTGGTTTTGGAGGCTGTGGCGTTTGGTACGTTTCTTTGGGACACGGAGTT
GTATGTAGAGGGAACGTATAAGCTTAAGGAGAATGGTAATGCAGAAGAGCAAGAGAACAGAAGCATATGA