Details for Kale Locus Bo5g141620

Position : C5 ( 5`- 43929516 .. 43931572 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141620

Protein [Map View]
MDNELFMNAGVLSHPSEMTSLSSSSPPAMLNWASMETHPLEQSITRNVPRDCFFGEKSTEQSIFGSALNSLVSPPPSESN
FSGGGAGENYVTRELVGDLGNIGDIYGAPASFGNGFGSCYATPMMSSPPLDAFSGDSRFAERAARFSCLGSRSFNGRRTN
GPVAETASINGEMTRVSSNSALKPPAGESSGESSRKRKAKSKEHSPSTASPSPNLSKEVEGKEDSDSKRSRKSQENGENT
KSLDPYKDFIHVRARRGQATDSHSLAERVRREKISERMKLLQELVPGCNKVTGKALMLDEIINYVQSLQRQVEFLSMKLS
SVNTRLDFNMDALMSKDIFPSSNNQQVPQLESSSHILLADHHSHTLQLNPNDSSNNIMNPMETSESRSFNSQLPTLTHLT
DSISQFSTYSEDDLHSIIHMGFAQNQIREPNQVHSTSFQGPSNQVPSHMKAEL*

DNA
ATGGACAACGAGCTGTTTATGAACGCAGGAGTACTTTCTCATCCGTCTGAGATGACGTCACTGTCTTCTTCTTCTCCTCC
GGCGATGCTGAATTGGGCTTCAATGGAGACTCATCCACTGGAGCAGAGTATCACTCGCAATGTGCCGCGTGATTGCTTTT
TTGGGGAAAAGTCAACGGAGCAGAGCATCTTCGGGTCAGCTCTGAACTCACTCGTGTCTCCACCACCGTCGGAATCTAAC
TTCTCCGGCGGAGGAGCCGGAGAGAATTACGTCACCAGAGAGCTCGTAGGTGATTTGGGAAACATCGGCGATATCTACGG
AGCTCCGGCGAGCTTCGGAAACGGCTTCGGGTCTTGTTACGCTACTCCGATGATGAGCTCTCCGCCGCTGGATGCATTTT
CCGGCGATTCGAGATTCGCAGAGAGAGCCGCGAGGTTCTCGTGTTTGGGAAGCCGTAGTTTTAACGGCAGAAGAACCAAC
GGACCCGTTGCTGAAACAGCGTCAATCAACGGGGAGATGACACGTGTCTCGAGCAACTCAGCTCTCAAGCCTCCCGCCGG
CGAATCCTCCGGTGAATCTTCCCGGAAAAGAAAAGCCAAATCCAAGGAGCATTCTCCCTCCACAGCTTCCCCATCTCCTA
ATTTATCAAAGGAAGTTGAAGGGAAGGAAGATTCTGATTCAAAGAGAAGCAGAAAGTCACAAGAAAATGGAGAGAACACG
AAGTCTCTTGATCCATACAAAGACTTCATCCATGTCAGAGCTCGACGTGGCCAAGCCACCGATAGTCACAGTCTCGCAGA
ACGAGTTCGAAGAGAGAAGATAAGCGAGAGAATGAAGCTGCTTCAAGAACTCGTCCCTGGATGCAACAAGGTTACTGGGA
AAGCACTGATGTTGGATGAAATTATAAACTATGTCCAATCATTACAACGACAAGTTGAGTTCTTGTCAATGAAGTTATCG
TCGGTGAACACCAGGCTGGATTTTAACATGGACGCTCTCATGTCAAAGGATATATTTCCTTCAAGCAACAATCAGCAAGT
ACCTCAGTTAGAATCTTCATCTCATATCTTATTGGCTGATCATCATAGTCATACTTTACAATTGAACCCAAATGATTCTT
CCAATAACATAATGAACCCTATGGAGACTTCTGAAAGTAGAAGCTTCAATTCTCAGTTACCAACACTTACCCATTTGACC
GACTCTATTTCTCAGTTTTCAACATATTCTGAAGATGATTTACATAGCATTATTCATATGGGGTTTGCACAAAACCAAAT
CCGTGAACCGAACCAAGTTCATTCAACTAGTTTTCAAGGTCCATCAAACCAAGTACCATCACACATGAAAGCTGAACTTT
GA