Details for Kale Locus Bo5g141610

Position : C5 ( 5`- 43921565 .. 43922503 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141610

Protein [Map View]
MGFSRAKRVTDPLADEVRARLVGCSFSSGSEHSGDGIDDYDDDSPCLSDLVQGFLEDEANQSVNEEPRWCDSDSESDSDS
DSERVDLPDFAEDIAKILRNTLGEDNYGRMVLFHVARAMEMLPSLGSDQEQRAVSRRKLMSLLRGFGHNAAICKTKWKSS
GGLTAGNHEFIDVVYTPAAAASPQTVRYIVDLDFASRFQIARPTAQYSRVLQSLPAVFVGRGDDLKRILRLVCDAARLSL
RSRGLTLPPWRKNRYLQTRWLGSYKRTVNLTPSSPAVNTVMCRAIGFDNAVGDRLSNLKNRATCHFLTRNFP*

DNA
ATGGGCTTCTCCAGAGCAAAACGTGTCACCGATCCACTAGCCGACGAGGTCAGGGCTCGTCTCGTTGGGTGCAGCTTCAG
CAGCGGCAGCGAACACTCCGGCGACGGTATCGACGACTACGACGATGATTCCCCTTGTCTTTCCGATCTAGTCCAAGGGT
TCTTGGAAGACGAAGCTAACCAGAGCGTTAACGAGGAGCCACGCTGGTGCGACAGCGACTCGGAATCAGACTCAGATTCT
GACTCGGAGCGAGTCGACCTCCCTGACTTTGCGGAAGATATTGCGAAGATTCTGAGGAACACTCTCGGGGAAGACAACTA
CGGACGAATGGTGCTGTTTCATGTCGCGAGAGCTATGGAAATGCTGCCGTCTCTGGGATCTGATCAAGAACAGCGTGCCG
TTTCGCGACGTAAGCTCATGTCCCTTCTTAGAGGGTTCGGACACAATGCGGCGATCTGCAAAACGAAATGGAAATCCTCC
GGCGGCCTCACCGCCGGCAACCACGAGTTTATCGACGTCGTTTACACACCCGCCGCCGCCGCCTCGCCTCAGACCGTACG
TTACATCGTCGATTTGGACTTCGCGTCGCGGTTTCAGATCGCCAGACCGACGGCACAGTACTCGCGTGTGCTTCAGTCGC
TTCCGGCGGTTTTTGTCGGGAGAGGGGATGATCTGAAGCGGATCTTACGCCTCGTGTGCGACGCGGCGAGGTTGTCGCTT
AGGAGCCGTGGCCTCACGCTTCCACCGTGGAGAAAAAACCGTTATTTGCAGACGCGGTGGCTTGGTTCTTACAAACGCAC
CGTGAACTTAACGCCATCATCTCCCGCCGTTAACACCGTCATGTGTCGTGCCATCGGTTTCGATAACGCCGTCGGTGACC
GTCTATCTAATTTAAAGAATAGAGCCACGTGTCATTTTTTAACTCGTAATTTTCCTTAA