Details for Kale Locus Bo5g141580

Position : C5 ( 5`- 43906354 .. 43909041 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141580

Protein [Map View]
MACITVNGNCSYYTFVTRSCLLHGSFEDGLTRREVIAHNVLTKKRKEIVERASQLDVVVSNRLARSEPRRQVEKKKYYLL
ELRSLFSSILFWRDSTHAPPEEEKFSVRSSRKKRESLRFDRIVLEMATGAVSPMAAKQAERLKEDGNNCFKKERFGAAID
AYTEAITLSPKVPVYWTNRALCHMKRKDWTRVEEDCRKAIQLDHDSVKAHYMLGLALLQKEEYADGVKALQRALDFGRGA
NPTGYMVEEIWEELSKAKYMEWELLSAGRSWELNSLKETCVAALNQQRALDMSRTEESSEEDYSSHTDQLKALDRVFEKA
AEEDKPTEVPDYLCCNITLEIFRDPVISPSGVTYERAAILEHINKVGKFDPITREELDPSKLVSNLAIKEAVAAYLEKHV
WAYKTGC*

DNA
ATGGCATGCATAACTGTAAATGGTAACTGCAGTTACTATACTTTTGTAACAAGAAGTTGCTTGCTGCACGGTAGCTTTGA
AGATGGCCTTACAAGACGTGAGGTGATTGCTCACAATGTGTTGACAAAGAAGAGGAAAGAGATTGTTGAGCGCGCTTCTC
AATTGGATGTTGTTGTTAGCAACAGATTGGCTAGGTCGGAGCCAAGGAGACAAGTAGAAAAAAAAAAGTACTATTTGCTT
GAACTTCGGAGTCTCTTCTCTTCGATTCTCTTTTGGAGAGATTCTACGCACGCGCCGCCGGAGGAGGAGAAGTTTAGCGT
GAGGAGTAGCAGGAAAAAGAGAGAATCTCTTCGTTTCGATCGAATCGTCTTAGAGATGGCGACAGGCGCGGTCTCCCCCA
TGGCGGCGAAACAAGCCGAGCGGTTAAAGGAAGACGGCAACAACTGCTTCAAGAAAGAACGCTTCGGCGCCGCCATCGAT
GCTTACACAGAGGCGATAACGTTGTCACCGAAGGTTCCTGTTTACTGGACTAATCGAGCTCTCTGCCACATGAAGCGAAA
GGATTGGACTAGGGTTGAAGAGGATTGTCGCAAAGCTATTCAGCTTGACCACGATTCTGTTAAGGCACACTACATGCTAG
GTCTTGCGTTATTGCAGAAGGAAGAATATGCTGATGGAGTCAAGGCGTTGCAAAGGGCTTTGGATTTTGGAAGAGGCGCA
AATCCAACAGGATATATGGTTGAAGAAATATGGGAAGAGCTTTCTAAAGCAAAATACATGGAGTGGGAACTGCTTTCCGC
GGGGCGCTCGTGGGAATTGAATAGTTTGAAGGAAACTTGCGTGGCTGCTCTTAATCAGCAACGTGCTTTAGATATGTCTC
GAACAGAAGAGTCCTCGGAAGAAGACTACTCTTCCCATACTGATCAGTTGAAAGCTCTTGATCGAGTTTTTGAGAAAGCT
GCTGAAGAAGACAAACCAACTGAGGTTCCAGATTACTTGTGTTGCAACATTACTCTTGAGATATTCCGAGATCCTGTGAT
TTCTCCAAGTGGGGTTACATATGAAAGAGCAGCAATCCTTGAACATATTAACAAGGTGGGAAAGTTTGATCCTATAACGC
GTGAGGAACTCGACCCATCCAAACTCGTTTCAAATCTGGCTATCAAAGAGGCAGTGGCTGCGTATCTAGAGAAGCACGTC
TGGGCTTACAAAACGGGTTGTTGA