Details for Kale Locus Bo5g141570

Position : C5 ( 5`- 43893819 .. 43894547 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141570

Protein [Map View]
MASHFSLPIVLAVACFVSLISPAVSQTCSTQNILTTQKTPFQTCLDLPVLDSYLHYTYNATNSSLSIAFVATPARPSGWV
AWAINPTGTGMAGSQAFVALRSRPGVAPVVKTYNISSYNSLVEGKLAFHFWDLRTEALTGNRVVIHTSVKVPAGEDSVNQ
VWQIGGNVTNGRIGIHPFTPANLNSKAVLRFSGSDAPASAPGSGPTTPGQAGGPGNAGSMTTSVNFGVTLGVLVLLGSMF
IF*

DNA
ATGGCTTCACATTTCTCTCTTCCTATTGTCTTAGCCGTTGCTTGTTTCGTTTCTCTCATCTCACCGGCGGTTTCACAAAC
TTGTTCTACTCAGAACATACTCACCACCCAGAAAACTCCCTTTCAGACTTGCCTAGACCTTCCCGTACTCGACTCCTACC
TTCACTACACTTACAATGCAACCAACTCGTCTCTCTCCATCGCCTTCGTCGCCACTCCAGCTCGACCCAGCGGCTGGGTC
GCTTGGGCTATCAACCCCACGGGGACTGGAATGGCCGGGTCTCAAGCCTTCGTAGCACTCAGATCCAGACCCGGTGTGGC
TCCCGTCGTGAAGACGTACAACATCAGTAGCTACAACAGTCTCGTCGAAGGAAAACTCGCCTTCCACTTTTGGGATCTAC
GCACCGAAGCCTTGACCGGGAACAGAGTCGTGATTCACACGTCGGTTAAGGTTCCGGCGGGAGAGGATAGCGTGAACCAG
GTGTGGCAGATCGGTGGGAATGTGACCAACGGTCGTATTGGAATTCATCCTTTTACTCCGGCTAATTTGAACTCTAAAGC
CGTTCTGAGATTTAGTGGCTCTGACGCTCCGGCCTCTGCTCCGGGAAGTGGCCCTACCACTCCCGGACAGGCGGGAGGTC
CAGGGAACGCGGGCTCGATGACAACAAGTGTAAACTTCGGGGTCACTTTGGGAGTTTTGGTTTTGTTGGGTAGTATGTTT
ATTTTCTGA