Details for Kale Locus Bo5g141540

Position : C5 ( 5`- 43871809 .. 43876288 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141540

Protein [Map View]
MESIQSRVESWIRDQRARFLRVSWGPLQWRFRWPPWNGEDADQRVKIRREYEKRKKQIQDLCLALKSESVEDLQDLLCCM
VLSECVYKRPASEMVRAVNKFKADFGGQFISLERVQPSSDHVPHRYLLAEAGDTLFASFVGTRQYKDIMADANILQGHIF
QDDVAEDECMAALPSDSQKNNGEGLRNPLDSKAKQRRDKPKPAAHRGFLARAKGIPALELYRLAQKKQRKLVLCGHSLGG
AVAALATLAILRAVAASSTKKGSENIHVKCITFSQPPVGNAALRDYVHEKGWHHYFKSYCIPEDLVPRILSPAYFHHYNE
QRISMAGEASEAEKTKGKEQEQLVIGVGPVQNSFWRLSRLVPLEAVKKQLDRYRGKKEDPAEESVVSSAPNEDVLMEPQS
LEIEEGGDGISLKPLPDSGNGQTVNGKSEGKTDSSNGFGNSWRRVPSLPSYVPFGELYLLGTASVESLSEGEYSKLTSVR
SVITELRERLQSHSMKSYRSRFQRIHDLCMDIDGFFGVDQQKQFPHLQQWLGLAVGGSVEIGHIVESPIIKTATSVAPLG
WNGVPGDKNAEPLKVDITGHGLHLCPFVHAQVNGNWCSTTVESFPSTPAFSSDNVEQTELQKIRVTIGAPLKRPPSNQIV
EDPLVPMFSSVDSNTGLVKEEISLGFFQEDKFVRPEGLEDLYIFCTSDFATVAKEVEVRTRRVRLLGLEGAGKTSLFRAI
LGQTMLSSMTHVENLQIQSDVQDCIVGGVCYSDTVGVNLQELQLEASRFREELWKGVRNLSKKIDLIILVHNLSHRVPRY
QNSTTQQQQPALALLLDEVKSLGIPWVLAITNKFSVSAHQQKTMIEAVLQAYQASPNSTGVVNSIPYVISGSGSSSLPWA
AVNAGNEGSLGAQKLIFAPLDLVKRPFQRKDTVFPVDGVSSLCQLVHRVLQSQEEACFQELAKERLLVELARSRAVDGSQ
GKPSSMSAAAVGASLGAGLGLVLAVVMGAGSALRKP*

DNA
ATGGAGTCGATACAGAGCCGAGTGGAATCGTGGATCAGAGACCAGAGGGCGAGGTTCCTACGCGTCTCGTGGGGACCACT
CCAGTGGAGGTTCCGGTGGCCACCGTGGAACGGAGAAGATGCCGATCAGAGGGTCAAGATCCGGCGCGAGTACGAGAAGC
GCAAAAAGCAGATTCAGGATCTTTGTCTCGCCCTCAAGTCGGAGTCGGTCGAAGATTTACAGGATTTGCTCTGTTGCATG
GTTCTGTCCGAATGTGTTTACAAAAGACCTGCAAGTGAGATGGTTCGAGCTGTAAACAAATTTAAAGCAGACTTTGGTGG
CCAATTCATTTCCTTGGAGCGAGTTCAGCCTTCATCAGATCATGTCCCTCACAGGTATCTACTCGCTGAGGCTGGTGATA
CTTTGTTTGCATCCTTTGTCGGAACTAGGCAGTACAAGGACATCATGGCCGATGCAAACATACTTCAAGGTCACATATTT
CAAGATGATGTCGCAGAGGATGAATGCATGGCAGCTCTACCAAGCGATTCACAGAAGAATAACGGAGAGGGTCTGCGGAA
TCCTCTTGATTCAAAGGCTAAGCAACGTAGAGATAAGCCTAAACCTGCTGCACATCGGGGATTCTTGGCTCGTGCTAAGG
GGATACCTGCTCTGGAATTATATAGACTTGCTCAGAAAAAGCAAAGGAAACTTGTATTATGTGGACATTCACTTGGTGGA
GCTGTTGCTGCGTTAGCTACACTCGCCATATTGAGGGCTGTTGCTGCCTCTTCTACAAAGAAAGGAAGTGAAAACATTCA
TGTCAAATGCATTACCTTTTCCCAGCCTCCTGTTGGGAACGCTGCGTTGCGAGATTACGTTCATGAAAAAGGGTGGCATC
ATTATTTCAAAAGCTACTGTATACCTGAAGATTTAGTCCCTAGAATCCTCTCTCCTGCATACTTTCATCACTACAATGAG
CAAAGAATATCAATGGCTGGAGAGGCATCAGAGGCGGAAAAGACAAAAGGCAAAGAACAGGAGCAGTTAGTCATCGGTGT
TGGCCCTGTTCAGAACTCATTCTGGAGGCTTTCAAGGCTTGTTCCTCTTGAGGCTGTTAAAAAACAGCTGGATAGGTATA
GAGGAAAGAAAGAGGATCCTGCAGAGGAATCTGTAGTGTCGTCGGCTCCTAACGAGGACGTGCTTATGGAACCACAGTCT
CTTGAGATTGAAGAGGGTGGGGATGGTATATCTCTCAAGCCGTTGCCAGATAGTGGCAACGGGCAAACGGTTAATGGGAA
GAGTGAAGGAAAGACCGATTCGTCCAATGGGTTTGGGAATAGCTGGCGCAGGGTTCCTTCTTTACCTTCTTACGTACCAT
TTGGAGAGCTATATCTCTTGGGAACTGCATCTGTGGAATCACTTTCAGAAGGAGAGTACTCTAAATTAACATCGGTCAGA
TCAGTGATTACCGAACTGAGAGAACGTCTTCAGTCACATTCTATGAAATCCTATAGGTCTCGCTTCCAGAGAATACATGA
CCTCTGCATGGATATTGATGGATTCTTCGGAGTGGATCAACAGAAGCAGTTTCCTCATTTACAACAGTGGCTTGGGCTTG
CTGTCGGTGGTAGTGTAGAGATCGGGCATATCGTTGAATCACCGATCATTAAAACCGCCACTTCTGTGGCTCCTCTTGGC
TGGAATGGCGTTCCTGGCGATAAGAATGCAGAACCTCTGAAAGTTGATATCACTGGTCATGGGTTGCACTTGTGTCCCTT
TGTTCATGCACAAGTGAATGGCAACTGGTGCTCAACAACTGTGGAATCCTTCCCTTCAACACCTGCCTTTTCTTCAGATA
ATGTAGAGCAGACGGAGCTACAGAAAATTAGAGTGACCATTGGAGCTCCTTTAAAACGACCTCCAAGCAATCAGATAGTT
GAAGATCCTTTAGTACCTATGTTCTCCTCTGTCGATTCAAACACCGGTTTGGTGAAGGAAGAAATCAGTTTAGGATTTTT
CCAAGAGGACAAGTTTGTTCGTCCCGAAGGTTTGGAGGACTTGTATATATTCTGTACTAGTGATTTCGCCACTGTGGCTA
AGGAGGTTGAGGTCAGAACACGGAGGGTGCGGTTACTCGGGCTTGAGGGTGCTGGTAAAACCTCTCTCTTCCGGGCCATA
CTGGGCCAAACCATGCTGAGTTCGATGACCCATGTGGAGAATCTGCAGATACAGTCCGATGTTCAAGACTGTATCGTTGG
TGGTGTTTGCTACTCCGACACAGTGGGTGTGAACCTGCAGGAGCTGCAGCTAGAGGCTTCTCGCTTTAGAGAAGAGCTAT
GGAAAGGAGTTCGCAACCTAAGTAAAAAAATAGATTTAATCATTCTTGTGCACAATCTCTCTCACAGAGTACCACGCTAC
CAGAACTCAACAACACAACAGCAGCAGCCAGCACTTGCTCTTCTGTTAGACGAGGTGAAGTCCCTCGGCATCCCTTGGGT
TCTAGCCATTACAAACAAGTTCTCAGTGAGTGCACATCAGCAGAAAACAATGATAGAAGCTGTTCTTCAGGCGTATCAAG
CGTCACCAAACTCAACCGGAGTTGTTAACTCTATCCCTTATGTTATCTCCGGCTCTGGGAGCTCCTCGTTGCCTTGGGCA
GCTGTGAACGCTGGTAATGAAGGATCATTAGGCGCTCAGAAGCTGATATTCGCTCCACTCGACCTTGTCAAAAGGCCTTT
TCAGAGAAAAGACACTGTGTTTCCAGTGGACGGTGTGAGTTCCCTTTGCCAGCTTGTCCACCGCGTCCTTCAAAGTCAAG
AAGAAGCTTGCTTTCAGGAACTTGCTAAAGAGAGACTGTTGGTGGAACTAGCCAGAAGCCGAGCCGTAGATGGTTCACAG
GGCAAGCCATCGTCGATGTCAGCAGCAGCTGTGGGTGCTTCACTTGGAGCAGGTCTTGGTCTTGTCTTAGCAGTTGTAAT
GGGTGCGGGTTCTGCTTTACGAAAGCCCTGA