Details for Kale Locus Bo5g141520

Position : C5 ( 5`- 43866400 .. 43866696 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141520

Protein [Map View]
MVRRNAVHATSSLPSRLWWPQQRRKGKRAVVRLGNRRRGFFVGQPRTVVQRWRMNIGKPMKIMRNIILGMISNGGNVKFF
DAYLWSLPILRPQLFPLC*

DNA
ATGGTAAGAAGAAACGCAGTTCATGCCACTTCAAGTCTTCCGTCTAGGCTTTGGTGGCCGCAGCAACGGAGGAAAGGAAA
AAGGGCCGTCGTGAGATTAGGAAACCGGCGACGAGGATTCTTTGTGGGACAACCGCGGACGGTGGTGCAGAGATGGAGGA
TGAACATCGGAAAACCAATGAAAATAATGAGAAATATCATTTTGGGAATGATCTCAAATGGTGGAAATGTTAAGTTCTTT
GATGCTTATCTTTGGTCTTTACCGATTTTACGTCCTCAGTTGTTTCCACTATGCTGA