Details for Kale Locus Bo5g141510

Position : C5 ( 5`- 43865674 .. 43865988 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141510

Protein [Map View]
MNNSHVLKTVILIMVLVEAVLIEEATAHPCGRTFLSALIQLVPCRPSVAPFSTLSPNGLCCAAIKRLGQPCLCALSKGPP
ISGVDRTLSLQLPGKCSANFPPCN*

DNA
ATGAATAACTCACACGTTCTTAAAACAGTCATATTGATTATGGTTTTGGTCGAGGCAGTCCTGATCGAAGAGGCGACGGC
ACACCCATGTGGTCGAACATTTTTGTCGGCTTTGATTCAACTCGTGCCGTGTAGACCATCAGTCGCGCCGTTTAGCACAT
TGTCTCCCAACGGGCTATGTTGCGCTGCCATCAAGAGGCTTGGTCAACCTTGTCTATGTGCTCTTTCCAAGGGACCACCT
ATCTCTGGTGTTGACCGCACTCTGTCACTTCAGTTACCTGGAAAATGTTCTGCCAATTTTCCTCCGTGTAACTAA