Details for Kale Locus Bo5g141500

Position : C5 ( 5`- 43861782 .. 43862727 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141500

Protein [Map View]
VSSCHQNVVFFFSSLLCLNLISLILTNKQIRESNEWSNAMIRILQISILCFFLVAGISISSSEEEEETIYKILQDNGLPS
GIFPKGVTEFTFDGETGRFSVYLNQSCDAKYETELRYDTNITGTLSSANVTDLSGISAQDLFLWFPVKGIRVDVPSSGLI
YFDVGVVRKQYSLSVFETPRDCVAVRRENEVESSVLSLHRVDETLGRNDI*

DNA
GTTTCAAGCTGTCACCAAAATGTCGTCTTCTTCTTCTCCTCCCTCCTCTGCTTAAACCTCATTAGTTTAATCCTAACGAA
CAAACAGATCAGAGAATCCAACGAGTGGTCCAACGCTATGATTCGTATCCTCCAAATCTCGATCCTCTGTTTCTTCCTCG
TTGCCGGGATCTCGATCTCCTCCTCCGAAGAGGAGGAGGAGACTATCTACAAGATCCTCCAGGACAACGGACTCCCGTCG
GGGATATTCCCTAAAGGCGTGACGGAATTCACCTTCGACGGCGAGACGGGACGGTTCTCCGTTTACTTGAACCAGTCGTG
CGACGCCAAGTACGAGACGGAGCTTCGCTACGACACGAATATCACCGGAACGCTGAGCTCTGCTAACGTAACTGATTTGT
CGGGAATATCGGCTCAGGATCTGTTCCTGTGGTTTCCGGTTAAAGGGATCCGTGTCGATGTCCCGAGCTCGGGGCTTATA
TACTTCGACGTTGGTGTCGTTCGCAAGCAGTACTCTTTGTCTGTGTTCGAGACGCCGAGAGATTGCGTCGCGGTTCGTCG
TGAAAATGAGGTTGAATCTTCTGTGTTGTCATTGCATCGAGTAGATGAAACTCTTGGGAGAAACGATATTTAG