Details for Kale Locus Bo5g141490

Position : C5 ( 5`- 43860161 .. 43860634 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141490

Protein [Map View]
MATNLLKFSSQIRRLSPLTRSLTVRTSATSTGSSGSKKVSDRIVKLSAIDADGDKKDIIGLSGQTLLRALTHTGLIDPLS
HRLEDIDACSAECEVQIAEEWLEKLPPRTYDEEYVLKRNSRSRVLNKHSRLGCQVVLTQELQGMVVAVPEAKPWDIP*

DNA
ATGGCGACGAATCTCCTGAAATTCTCCTCTCAAATCCGCCGCCTCTCTCCACTCACCAGATCCCTAACCGTCCGCACCTC
CGCCACATCCACCGGATCATCAGGATCGAAGAAAGTCTCCGACCGAATCGTCAAGCTCTCCGCGATCGATGCCGACGGAG
ACAAGAAGGACATCATCGGCCTCTCCGGCCAGACTCTCCTCCGCGCGCTCACCCACACCGGCCTGATCGATCCGCTGTCG
CATAGGTTGGAGGACATCGACGCTTGCTCGGCCGAGTGCGAGGTCCAGATCGCTGAGGAGTGGCTCGAGAAGCTCCCGCC
CCGTACCTACGACGAGGAGTACGTGCTGAAGCGTAACTCGAGATCACGTGTGCTGAACAAGCACTCGCGTCTCGGGTGTC
AGGTTGTGTTGACGCAGGAGCTTCAAGGTATGGTTGTGGCTGTCCCTGAAGCTAAGCCTTGGGACATCCCGTAA