Details for Kale Locus Bo5g141470

Position : C5 ( 5`- 43855180 .. 43855998 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141470

Protein [Map View]
MENIVTEEASSVVEPFIGMEFESEEAAKSFYDSYAKSTGFVMRVDAFRRSMRDGTVVWRKLVCNKEGFRRSRPRRSESRK
PRAITREGCKALIVVKKDKSGKWIVTKFVKEHNHPLLSLLANARRSSHISQSPDEKDAKIRELSTELSRERKRCAALQQQ
LDMVLNVMEEHANHLSVNINNVIQSVKEIESITFTKSLIS*

DNA
ATGGAGAATATAGTAACAGAAGAAGCTTCTTCAGTTGTGGAGCCTTTCATTGGTATGGAGTTTGAATCAGAAGAAGCTGC
AAAGTCTTTCTACGACAGTTACGCTAAAAGCACTGGTTTCGTTATGAGAGTGGATGCTTTCAGGAGGTCAATGCGAGACG
GGACCGTGGTGTGGCGCAAACTCGTGTGTAACAAAGAAGGGTTCCGTAGATCAAGACCTAGGAGAAGCGAGAGCAGGAAG
CCTCGTGCTATAACAAGAGAAGGATGTAAGGCTTTGATCGTGGTGAAGAAAGACAAGTCCGGAAAATGGATCGTCACTAA
GTTTGTGAAAGAACATAATCATCCTCTCTTGTCTCTACTTGCTAACGCTCGCCGGAGTTCACATATCTCTCAATCACCGG
ACGAGAAAGACGCAAAGATTAGGGAGCTTAGCACAGAGCTGAGCCGAGAGAGAAAGCGTTGTGCTGCGTTGCAACAGCAA
CTTGATATGGTCCTAAACGTGATGGAAGAACATGCTAATCATCTCTCTGTCAATATCAATAATGTTATCCAAAGTGTAAA
AGAAATAGAGTCCATTACTTTCACCAAATCCCTGATCAGCTGA