Details for Kale Locus Bo5g141460

Position : C5 ( 5`- 43854111 .. 43854644 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141460

Protein [Map View]
MTSPASSSVATTSVHVSALDGLVNVNSLFTIAVFVGLSLATPGQHSLEQRSNCDASDDVAKKLLVFEVVSFSFFLFSSLV
AQGLKLALNLLNSKDVDEIFRAHINIKVLRWGMMASAVGSVMGCLFMMLSMVNVIQIRLGLLSCGSKSAVQAVATLVTLV
SSALLVYISTAFYAFWH*

DNA
ATGACGTCACCGGCATCTTCCTCCGTCGCCACAACAAGCGTCCACGTAAGCGCACTCGACGGGCTCGTCAACGTGAACTC
CCTCTTCACAATCGCCGTCTTCGTCGGCCTCTCCTTAGCCACCCCGGGACAGCACAGCCTCGAGCAGCGGTCAAACTGCG
ACGCGAGCGACGACGTGGCGAAGAAGCTGCTGGTCTTCGAAGTCGTCTCCTTCAGCTTCTTCCTCTTCTCCTCCCTCGTG
GCTCAGGGTCTCAAGCTCGCGCTGAACCTCCTCAACAGCAAAGACGTGGACGAGATTTTCAGGGCGCATATCAACATCAA
GGTGCTGAGATGGGGAATGATGGCGTCTGCGGTTGGATCTGTGATGGGTTGTTTGTTCATGATGCTCTCTATGGTTAATG
TGATTCAGATCCGTTTGGGGTTGCTATCTTGCGGTAGTAAATCTGCGGTTCAGGCGGTTGCGACGCTTGTGACGCTGGTT
TCCTCTGCTCTGTTGGTTTATATCTCTACTGCCTTTTACGCTTTTTGGCACTGA