Details for Kale Locus Bo5g141450

Position : C5 ( 5`- 43851993 .. 43853063 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141450

Protein [Map View]
MDSAGEVVNDGKITLEGFSVAARAFADKWKRHNLSFPSWSWVSLINRTLLKKEECYLSLEKIIILSSLEGSAEEESLDVT
ADWWEKEESIDHTVLVQNVEDEAHYYDYHIVYSASYMVPMLYFRGYSSDGKPLSLDVIKRDLPSSSVSLLLESKWTFITQ
EEHPYLNRPWFKLHPCGTEEWIKLLSESSSSDGCQMPVELYLVSWFSVVGQVVGLRTPLEMLI*

DNA
ATGGATTCAGCTGGAGAGGTCGTCAACGACGGCAAAATCACTCTCGAGGGTTTCTCTGTCGCTGCTCGAGCTTTCGCGGA
TAAATGGAAAAGACATAACCTTTCGTTCCCTTCATGGTCATGGGTTTCTCTGATCAATCGAACGCTACTTAAGAAGGAGG
AATGTTACTTATCGCTAGAGAAAATCATCATTCTCAGCTCACTTGAGGGAAGTGCTGAGGAGGAGTCTTTAGATGTAACA
GCTGATTGGTGGGAGAAGGAAGAATCAATTGATCACACGGTCTTGGTACAAAACGTTGAAGATGAAGCACACTACTATGA
TTACCATATCGTTTACAGTGCGTCATACATGGTTCCTATGCTGTATTTTCGTGGATACTCTAGTGATGGAAAGCCTCTTT
CTTTGGATGTTATCAAGAGAGATCTGCCTTCAAGCTCTGTTAGTCTTTTGCTGGAATCTAAGTGGACTTTTATAACACAG
GAGGAGCATCCGTATTTGAACAGGCCGTGGTTCAAGCTGCATCCTTGTGGGACTGAGGAATGGATCAAGCTGCTTTCCGA
AAGCAGCAGCTCTGATGGTTGTCAGATGCCAGTCGAGTTGTACTTGGTTTCATGGTTCTCTGTTGTCGGGCAGGTTGTTG
GTCTTAGGACCCCTCTTGAGATGCTGATTTAG