Details for Kale Locus Bo5g141400

Position : C5 ( 5`- 43818128 .. 43820935 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141400

Protein [Map View]
MLNLSGFRILIDCPLDLLALTIFSPLPCDVGIEAYGQNDQNPIEKKQKLERQMTPDDLVSAEPWYKTIKTLHLWEASLID
IVLISNPMGLLGLPFLTQNPRFCAKIYMTEATAKIGQLMMEDLVSMHMEFRRLHGPEDSSFPWWTKNLDGEEVPSVLKNI
VFGENGNDLGSWMRLYSLDDVKSCMKKVQDVKFSEEVCYNGTLIIKALSSGLDIGDCNWLINGPNGSLSYVSDSIFVSHH
SKNFDFHGLKGTDVMIYSGFSCLQSAEITDSDCISTISENNDERLAASLLDNEESLGELEKLAFVCSCAAESADAGGSTL
ITITRVGIVLQLLELLSNSIESSSLKVPIFVISSVAEELLAYANTIPEWLCEQRQEKLISGEPSFDHLKFIKDKKIHLFP
AVHSPNLITSWQEPCMVFAPHWSLRLGPSVQLLQRWRGDPKSLLVLEDGISSGLGLLPFRPIAMKILQCSFLSGIRLQKF
PTLLSLLKPKILLVPDVVNQRINLSTVKTKSILSYSENKMLSVGRIAENADVEIMAELATKLSWKKLRQRENFGIARLKG
DFVMENGKQRLVSGLDQEGSSGKTRSLRHWGTVAPETLLDALMKMSVIGSIEHRRGENGAEGKSIIYITNPSGGMIETSE
MGTAIITDDETVASKIFQAIDGILDGI*

DNA
ATGCTGAACCTAAGTGGTTTCAGGATCTTGATCGACTGCCCTTTGGACCTTTTAGCTCTCACAATCTTCTCTCCTCTTCC
ATGTGATGTGGGGATTGAAGCTTATGGTCAGAATGATCAGAATCCAATTGAAAAGAAGCAGAAACTGGAGAGACAGATGA
CTCCTGATGATTTGGTATCCGCAGAGCCGTGGTACAAAACTATTAAGACCTTGCATTTGTGGGAAGCTTCTTTGATCGAT
ATAGTTCTCATCTCCAACCCTATGGGATTGCTCGGATTGCCATTCCTTACTCAAAACCCAAGATTCTGCGCCAAGATTTA
TATGACTGAAGCAACAGCTAAGATTGGTCAGCTCATGATGGAAGATCTTGTCTCTATGCACATGGAGTTCAGACGCTTAC
ACGGACCTGAGGACTCTAGTTTTCCTTGGTGGACAAAGAATTTAGATGGTGAAGAAGTACCAAGTGTGCTTAAGAATATT
GTCTTTGGTGAGAATGGTAATGATCTAGGCAGTTGGATGCGTCTCTACAGTTTAGATGACGTAAAGAGTTGCATGAAGAA
GGTTCAAGATGTAAAGTTTTCAGAAGAAGTTTGTTATAATGGGACGTTGATCATTAAGGCTCTAAGTTCAGGTCTAGATA
TTGGGGATTGCAATTGGTTGATCAATGGCCCTAATGGAAGTTTAAGTTATGTGTCAGACTCCATCTTCGTTTCACATCAT
TCGAAAAATTTCGACTTCCATGGTCTCAAAGGAACCGATGTGATGATTTACTCTGGTTTCTCATGCCTCCAATCCGCAGA
AATTACTGATAGTGATTGTATATCAACAATCAGTGAGAATAATGACGAGAGATTGGCTGCTTCGTTACTAGACAATGAAG
AAAGCTTAGGAGAGCTAGAGAAGCTAGCTTTTGTCTGCTCATGTGCTGCGGAATCTGCGGATGCTGGTGGCTCAACCTTA
ATAACGATTACTCGAGTGGGGATAGTTCTGCAGCTCCTTGAGCTATTGTCAAACTCTATTGAGTCCTCTTCTCTAAAGGT
TCCAATATTTGTAATATCTTCTGTGGCAGAAGAGCTATTGGCATACGCAAACACCATACCAGAGTGGCTGTGCGAGCAAC
GACAGGAGAAGTTAATTTCAGGAGAACCTTCATTTGATCATCTTAAATTCATCAAAGACAAGAAGATCCATTTGTTTCCT
GCCGTTCACTCACCCAACTTAATAACAAGTTGGCAAGAACCATGCATGGTGTTTGCTCCTCACTGGAGTTTACGGCTTGG
CCCTTCTGTCCAGCTTCTTCAGCGTTGGCGTGGAGATCCAAAATCATTGCTTGTTCTTGAGGACGGTATAAGTTCAGGTT
TAGGACTTCTCCCCTTCAGACCAATCGCTATGAAGATTCTCCAATGTTCATTTCTTTCTGGAATTAGGTTGCAGAAGTTC
CCAACACTTCTTTCCCTTTTGAAGCCAAAGATTCTTTTGGTCCCTGATGTTGTCAACCAGAGGATCAACCTTTCTACGGT
GAAGACAAAATCTATCCTGAGTTACTCCGAGAACAAGATGCTAAGTGTGGGAAGAATTGCAGAGAATGCAGACGTAGAGA
TAATGGCAGAGTTAGCCACCAAACTGAGCTGGAAGAAACTCAGACAGCGTGAAAACTTTGGTATTGCGAGGTTGAAAGGT
GACTTTGTGATGGAAAATGGGAAACAGAGATTGGTTTCCGGGTTGGATCAGGAAGGAAGTTCAGGAAAGACTCGGTCATT
GAGGCATTGGGGCACTGTGGCTCCTGAAACACTTTTGGATGCGTTAATGAAGATGAGTGTAATCGGATCGATAGAACACA
GGAGAGGTGAGAATGGAGCAGAAGGCAAGAGTATTATCTATATAACAAATCCTAGCGGTGGAATGATAGAGACCTCAGAG
ATGGGTACTGCTATTATAACAGACGATGAGACTGTGGCCTCTAAGATCTTCCAAGCGATTGATGGAATCCTTGACGGTAT
TTAG