Details for Kale Locus Bo5g141380

Position : C5 ( 5`- 43808434 .. 43809856 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141380

Protein [Map View]
LEVPPSFVFFSLSLSLSLSALEGRRRRTSKSSLIVSVMASSQPSGGRPPKPWEQEGNNNASGPKPFRPPSNTSTADSVEA
SGTANPGELVSSVNRTNTAPTMNGLSRPVPTRPWEQQTYGNIYGSNLGMNAGYGSSYGGGMYGGSGMYNRGGYGGGGGGL
YGSSGMYGGGGGMYNSSFGGGYGMGMGTGMGMGMGMGMGMSPYGGQDPNDPFNQPPSPPGFWISFLRVMQGAVNFFGRVA
MLIDQNTQAFHMFMSALLQLFDRGGMLYGELARFVLRMLGVRTKPRKMQQQPQGPNGLSLPHQPHGNQNYLEVPKAAAAP
GGGGWDNVWGN*

DNA
CTCGAGGTCCCTCCCTCCTTTGTCTTCTTCTCTCTCTCTCTCTCTCTCTCTCTCTCCGCGCTTGAAGGTAGGCGTCGGAG
AACTTCCAAAAGCTCTCTAATCGTGTCGGTTATGGCTTCGTCTCAACCATCAGGTGGAAGACCTCCTAAGCCTTGGGAAC
AAGAAGGGAACAACAACGCATCTGGTCCTAAGCCTTTTAGGCCTCCTTCGAATACGAGCACTGCTGATTCAGTTGAGGCT
TCGGGCACTGCGAACCCCGGTGAGCTAGTTTCTTCCGTGAATAGGACTAACACAGCTCCTACTATGAATGGACTGAGTAG
ACCTGTTCCAACTAGGCCTTGGGAGCAGCAGACCTATGGAAACATTTATGGTTCAAACCTGGGTATGAACGCTGGGTATG
GTTCGTCATATGGGGGAGGAATGTATGGTGGTAGTGGGATGTATAATAGAGGAGGTTATGGTGGTGGTGGTGGTGGTCTC
TATGGAAGTTCAGGTATGTATGGTGGTGGTGGTGGGATGTATAACAGTAGTTTTGGTGGTGGTTATGGTATGGGTATGGG
GACAGGAATGGGCATGGGCATGGGCATGGGCATGGGAATGAGTCCTTATGGTGGTCAAGATCCAAATGACCCTTTTAATC
AACCTCCTTCTCCACCTGGCTTCTGGATATCATTTCTCCGTGTGATGCAAGGTGCTGTGAATTTCTTTGGCCGTGTAGCG
ATGCTGATTGACCAAAACACACAGGCCTTTCATATGTTCATGTCTGCTCTTCTTCAGCTATTTGATCGTGGCGGTATGTT
ATATGGAGAATTAGCGAGATTTGTGCTGCGTATGCTTGGGGTGAGAACAAAGCCTAGAAAGATGCAGCAGCAGCCACAAG
GGCCTAATGGACTCTCTCTACCCCACCAGCCACATGGAAACCAGAACTACCTCGAAGTTCCTAAAGCCGCCGCTGCACCA
GGTGGTGGTGGTTGGGACAATGTATGGGGTAACTAA