Details for Kale Locus Bo5g141370

Position : C5 ( 5`- 43802231 .. 43804291 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141370

Protein [Map View]
MRLNFFVSFVFFGLISLQLPPLSTQQATESCSSTLPLNDLTFDSTLLQCVEAWTPQNYILRYAKTVDNTWSFILSAPDSS
AYIGIGFSTNGQMTGASAVVGWIPTDGRGQAKQYLLGGKSPGEVKPDQGDLNIVNGSLKIESVSSRLYMSFQLTAELPRQ
ILLYAMGPAGFIPASPGFSLREHRDMTTTTINYNTGSQSVVKGSPHSKLRKTHGLMNMFGWGILIIIGALVARHMKQWQP
TWFYAHIALQTTGFLLGLTGIICGLVLENRTDANNVSKHKGLGITIFVMGILQVLALLARPDKDSKYRKYWNWYHHNVGR
VMIILAISNIFYGIHLADAGSSWNGGYGFVVAVLASAAIGLEVIKFRNK*

DNA
ATGAGGCTTAATTTCTTTGTCTCCTTCGTCTTCTTCGGCTTAATCTCTCTTCAACTTCCACCTCTGTCCACTCAGCAAGC
TACGGAATCATGCAGCTCAACTCTACCTCTCAACGACCTCACCTTTGACTCAACCCTCCTTCAATGCGTCGAAGCTTGGA
CTCCCCAAAACTACATCCTCCGATATGCTAAAACGGTGGACAACACATGGAGCTTCATCTTATCGGCTCCAGACTCCAGC
GCCTACATAGGGATCGGATTCTCCACCAACGGTCAGATGACCGGAGCCAGCGCGGTCGTCGGGTGGATACCAACCGACGG
CCGAGGTCAGGCGAAACAGTACTTGCTCGGAGGGAAGTCTCCAGGCGAGGTGAAGCCTGACCAAGGCGATCTGAATATCG
TCAACGGCTCGTTGAAGATCGAGTCAGTGTCGTCGCGTCTCTACATGAGCTTTCAGCTGACGGCGGAGCTGCCGCGGCAG
ATCCTTCTTTACGCCATGGGACCTGCCGGATTCATTCCAGCTTCGCCGGGTTTTAGTTTGAGGGAGCATCGTGACATGAC
CACCACGACTATCAATTATAATACAGGTTCGCAAAGTGTGGTTAAGGGTTCACCACATTCTAAGCTAAGGAAGACACATG
GGCTTATGAACATGTTCGGCTGGGGAATATTAATCATCATCGGCGCCTTAGTGGCTCGACACATGAAGCAATGGCAACCC
ACTTGGTTCTATGCCCATATAGCTCTCCAAACCACTGGTTTTCTCCTAGGTTTAACTGGTATCATTTGCGGTTTGGTTCT
TGAAAACCGGACCGATGCCAACAATGTCTCCAAGCACAAAGGCCTTGGGATAACAATCTTTGTCATGGGCATTCTCCAGG
TTCTAGCGTTGCTGGCTCGACCGGACAAAGACTCGAAATACAGAAAATACTGGAATTGGTATCATCATAACGTAGGAAGA
GTTATGATAATACTTGCTATCTCCAACATCTTCTATGGTATTCATTTGGCTGATGCTGGCTCTTCATGGAACGGCGGTTA
TGGTTTTGTGGTTGCTGTCTTGGCTTCGGCTGCTATTGGATTAGAAGTTATAAAGTTTAGGAACAAGTGA