Details for Kale Locus Bo5g141360

Position : C5 ( 5`- 43799506 .. 43800938 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141360

Protein [Map View]
MADPSYNTKKYTPPGLRNPSGVNKKIGDRAGSQQSKDGERSQPQMEKASQKIITLKDSATSEAYQLLSERWAAAMHQYND
PTVDLSERPVMYYGGSVWGKLPHQILASANNTLPPKITPADYRAEVRRGLLTPRSSSN*

DNA
ATGGCGGATCCGAGCTACAACACGAAGAAGTACACTCCCCCTGGTCTAAGGAATCCGTCTGGTGTCAACAAGAAGATAGG
AGATCGTGCAGGTAGCCAGCAGAGCAAAGATGGTGAGAGAAGTCAGCCTCAGATGGAGAAAGCTTCCCAAAAGATTATCA
CTCTAAAGGACAGCGCTACGAGTGAAGCTTATCAGCTTTTAAGCGAACGCTGGGCAGCTGCAATGCACCAATACAACGAC
CCAACCGTGGATTTATCTGAACGACCAGTCATGTACTATGGAGGGAGTGTTTGGGGTAAACTGCCTCACCAGATCCTGGC
TTCGGCGAACAATACACTGCCTCCAAAGATAACGCCAGCGGATTACAGAGCTGAAGTGCGCCGAGGATTGCTGACTCCAA
GAAGTTCTAGCAACTGA