Details for Kale Locus Bo5g141350

Position : C5 ( 5`- 43798356 .. 43799146 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141350

Protein [Map View]
IQNRSRIRPPLAKKGFEVFAASAVSSPVSSSSHPKMKLVRFLMKLNNETVSIELKNGTVVHGTITGVDVSMNTHLKTVKM
TLKGKNPVTMDHLSLRGNNIRYYILPDSLNLETLLVEDTPRVKPKKPVAGKPVGRGRGRGGRGRGGAGRGRGR*

DNA
ATCCAAAATCGAAGTCGGATCCGTCCCCCGCTTGCGAAGAAGGGTTTTGAGGTTTTCGCAGCGTCTGCAGTTTCGTCGCC
AGTCTCTTCTTCCTCACACCCAAAGATGAAGCTCGTCAGGTTTTTGATGAAGCTGAACAATGAAACTGTGTCGATCGAGC
TGAAGAACGGGACTGTGGTCCATGGAACCATCACTGGTGTTGATGTGAGCATGAATACTCACTTGAAGACTGTTAAAATG
ACCCTGAAGGGGAAGAACCCAGTGACAATGGACCATCTAAGCTTGAGGGGTAACAACATCCGCTACTACATTCTTCCTGA
TAGCTTGAACCTCGAGACTTTGCTTGTGGAAGACACTCCTCGAGTCAAGCCTAAGAAGCCTGTTGCTGGGAAACCTGTTG
GACGAGGCCGTGGACGTGGTGGTCGTGGGCGTGGTGGTGCTGGTCGTGGCAGAGGTCGTTAA