Details for Kale Locus Bo5g141330

Position : C5 ( 5`- 43792028 .. 43792721 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141330

Protein [Map View]
MSIKQKILIRVTMTDDKTRAKAMKTAAQFKGVSAVEIKGDHRNQIEVTGVEVNMICLTNTLRKKVAFAELVSVNKVEPPK
KEDDKKKDDKKPDEKKADEKKTDEKKDEEKKPEPCCCNPCYQPWPYGYGVPSSSPHPCDPYGYNFRDYTGEPFYNYGPNW
RFM*

DNA
ATGAGCATCAAGCAAAAGATTCTGATAAGAGTTACTATGACTGATGATAAAACTAGAGCAAAAGCAATGAAAACTGCCGC
TCAGTTTAAAGGAGTCTCGGCTGTGGAAATAAAGGGAGATCACAGGAACCAGATTGAGGTGACCGGTGTTGAAGTCAATA
TGATCTGTCTAACCAACACACTGAGGAAGAAAGTAGCCTTCGCTGAGCTTGTAAGCGTAAACAAAGTTGAACCACCCAAG
AAAGAGGACGACAAGAAGAAGGATGACAAGAAACCAGATGAGAAGAAAGCTGACGAGAAAAAAACAGATGAGAAAAAAGA
TGAGGAGAAAAAGCCAGAGCCGTGTTGTTGTAATCCATGTTATCAACCCTGGCCTTACGGATATGGTGTGCCGTCTTCCT
CTCCACATCCGTGTGATCCCTACGGGTATAACTTTAGAGATTATACTGGGGAACCTTTCTACAACTACGGACCCAATTGG
AGGTTCATGTGA