Details for Kale Locus Bo5g141310

Position : C5 ( 5`- 43775752 .. 43777818 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141310

Protein [Map View]
MAVRLQATQVPGGISGNLSPSNRNPNAVIRFGRGSSKRNRLVSLSASLREGDGRGKESSVRAVEVKKILEDSPLLPKPLS
SNQLAETVSNGSRVRVAYQGVRGAYSESAAEKAYPNCEAVPCEEFDTAFEAVERWLVDRAVLPIENSLGGSIHRNYDLLL
RHNLHIVGEVKLAVRHCLLANHGVKLEDLRRVLSHPQALAQCENTLTRLGLVREAVDDTAGAAKQIAFEDLSDAAAVASA
KAAEIYGLNIVAEDIQDDTDNVTRFLMLAREPIIPGTNRLFKTSIVFSLEEGPGVLFKALAVFALRQINLTKIESRPLRK
NPLRASGGLKYFDYLFYVDFEASMADEVAQNALRHLEEFATFLRVLGSYPVDTTML*

DNA
ATGGCTGTTCGATTGCAGGCGACTCAGGTCCCCGGTGGAATCTCCGGAAACCTCTCACCATCCAATCGCAATCCAAACGC
CGTCATCCGATTCGGTCGCGGATCTTCGAAGCGCAACCGTTTGGTATCTTTATCGGCGTCGCTCCGGGAAGGGGATGGAC
GTGGGAAAGAGAGCTCCGTGAGAGCTGTGGAAGTGAAGAAGATCCTGGAAGACTCACCTCTGCTTCCTAAGCCGTTATCG
TCAAATCAGCTCGCGGAAACTGTCTCCAACGGCTCTCGTGTTCGTGTAGCCTATCAGGGAGTAAGAGGTGCATACAGTGA
ATCAGCAGCTGAGAAGGCTTATCCAAACTGTGAAGCTGTTCCTTGCGAAGAGTTTGACACTGCCTTTGAGGCGGTTGAGC
GGTGGCTTGTTGACCGAGCAGTTTTGCCTATTGAGAACTCTTTAGGTGGAAGCATCCATAGAAACTATGATCTTTTGCTG
CGTCACAATCTGCACATTGTTGGGGAAGTCAAGTTAGCTGTTCGCCACTGTTTGTTGGCCAACCACGGTGTAAAGCTTGA
AGATTTGAGAAGGGTGCTTAGCCATCCACAGGCTCTGGCTCAATGTGAAAACACGTTAACTAGATTGGGATTGGTCAGAG
AAGCAGTAGATGACACTGCTGGTGCTGCTAAGCAAATTGCATTCGAAGATTTAAGTGATGCAGCTGCAGTTGCGAGCGCC
AAAGCTGCAGAGATATATGGGTTGAACATAGTTGCTGAAGATATCCAGGATGACACTGATAATGTTACAAGGTTTCTAAT
GCTCGCAAGGGAACCCATTATCCCTGGAACTAACAGACTCTTTAAGACAAGTATAGTTTTCTCGTTAGAGGAAGGGCCTG
GAGTACTTTTCAAAGCACTTGCGGTCTTTGCCCTTAGGCAAATTAACCTCACAAAGATCGAAAGCCGACCTTTAAGGAAA
AACCCTCTGCGAGCATCTGGAGGGCTTAAATACTTTGATTATCTTTTCTATGTGGACTTCGAAGCATCTATGGCTGACGA
AGTTGCTCAAAATGCACTTAGGCATCTCGAGGAATTTGCTACCTTTTTGCGGGTACTGGGAAGCTACCCAGTGGACACAA
CAATGCTCTAA