Details for Kale Locus Bo5g141290

Position : C5 ( 5`- 43769485 .. 43771022 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141290

Protein [Map View]
MGYMCDFCGEQRSMVYCRSDAACLCLSCDRSVHSANALSKRHSRTLVCERCNAQPATVRCVEERVSLCQNCDWSGHNNNN
NNSSSSSSNNHKRQTISCYSGCPSSSELASIWSFCLELAGQSGCEQEMGMMNIDDDGQGNQNCNEDKKDVVAGSSSRPET
SSALPATSSFPKDVRVCEDDFYGNLGMDEVDLALENYEELFGTAFNTSGELFGQGGIDSLFQKHHQAAAPEGGNLVQPAE
SNDDSFMSSKTEPIICFTSKPAHSNISFSGVTGDCSAGDFQECGASSSMQLSGEPPWYPQASSQDNNASSHSVTRNNAVM
RYKEKKKARKFDKTVRYASRKARADVRRRVKGRFVKAGEAYDYDPLTPTRSY*

DNA
ATGGGTTACATGTGTGACTTCTGTGGTGAACAAAGATCAATGGTTTACTGTCGCTCCGACGCAGCCTGTCTCTGCCTCTC
CTGCGACAGGAGCGTCCACTCTGCTAACGCATTGTCCAAACGACATTCTAGAACGCTCGTCTGCGAGAGATGCAATGCTC
AGCCTGCTACGGTCAGGTGTGTTGAAGAAAGGGTTTCCCTCTGTCAAAACTGTGATTGGTCTGGCCACAACAACAACAAC
AACAATTCTTCTTCTTCTTCGTCAAATAATCACAAGAGGCAAACCATAAGCTGCTATTCTGGTTGCCCTTCGAGCTCGGA
GCTCGCCTCTATCTGGTCTTTCTGTTTGGAGTTAGCTGGACAATCAGGCTGTGAGCAAGAAATGGGTATGATGAATATAG
ATGATGATGGTCAGGGCAACCAAAACTGTAATGAGGATAAGAAAGATGTGGTCGCCGGCTCCTCCTCAAGGCCTGAAACC
AGTTCTGCTCTACCTGCAACTTCATCATTTCCCAAGGATGTTAGAGTATGTGAAGATGACTTTTATGGGAACTTGGGTAT
GGATGAAGTTGACTTGGCTCTTGAGAACTATGAAGAGCTCTTTGGGACAGCCTTTAACACCTCTGGAGAGCTCTTTGGAC
AAGGTGGAATTGATAGTCTTTTCCAGAAACATCATCAAGCAGCAGCTCCTGAGGGAGGGAATCTGGTGCAGCCAGCTGAG
AGCAATGATGATTCTTTCATGAGTTCGAAAACAGAGCCAATCATTTGCTTCACATCGAAGCCAGCACATTCCAACATATC
TTTCTCTGGAGTCACCGGAGATTGCAGCGCTGGAGATTTTCAAGAATGTGGTGCATCATCTTCCATGCAGCTCTCAGGGG
AGCCACCATGGTATCCTCAAGCATCATCACAGGATAACAATGCTTCCTCACATTCAGTGACTCGTAATAACGCTGTTATG
CGTTACAAGGAGAAAAAGAAGGCTCGCAAGTTTGATAAGACAGTGAGGTATGCTTCTCGCAAAGCAAGAGCTGATGTGAG
ACGGCGTGTGAAGGGGAGATTTGTCAAAGCTGGTGAAGCTTATGACTATGACCCACTCACCCCAACCAGAAGCTACTGA