Details for Kale Locus Bo5g141280

Position : C5 ( 5`- 43764594 .. 43768381 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141280

Protein [Map View]
MVGSGARVSIDADTRKTIQTIKEITAGNYSEDEIHAMLLECSMNPDEAAQRLLLQDPFLEVKKKRDKRKENLSSKDSVEP
QWRCGGGGRINLSSRHSSHGKHHSDGAGAKIFFRKENGPKQVAHPSTSTSQKQIKTKDNALVFSLPPVMDKSSGCLTSGS
SDGAPPSAVESSKNRVNTEQKSADSLPLSRPPSSEVRFISSNSKPVSEQHLGERKLQNRSRGTGNTLVNDAYVPRPASSH
SNSTSSRPSSNYSNRSHQTVGPQRGKEWKPKPVNHTTTQGSGASATAEALAVPTEASEKSVEDVVPSAEGTSKLQRQLED
LQVQRQHVIIPNHILVPDAERTKFSFGSFDAGFSIASSSVAFPENEKRSAPLSQNSQEVEDSFEEDELSHPNVHSTEKDE
ENNVYSESPSQVPNDMAGEGITAANAAPVYDVSKQENTLESESNHSPFDHIPSNILGPIPPAPGSQLPQFENADPQARDA
LRTPNFVVQQPFDTASYYAQFYRSGPDSDGRVSPFVSPGVASKFNGNVTVLPPHSSQTMQESGNNLVLSTASPTPLATQP
AGLMQSSIPVTQQPVPFLRPPGLHMSHYPPNYMPYGHYFSPFYLPHPAMQQFLSNGAFAQQPQASSVYPAPPPPSGAATG
GKYTLPHHKPGSNTGNLTHVGMPGGYGPTSHGSFPAGYNPNSGASAGNSTSNEDLSTLQLKGNNGYSTTGQQSEALPVWI
AGPGRDVPSSFYGLQHHGQQHVTYAPAQSGHVTFPGMYHPGQAVTAAGGVHHPLLQQSQGVAGAEMVAPGPPNVFQQPQQ
TPMNWPSNY*

DNA
ATGGTTGGGAGTGGTGCTAGGGTTTCGATTGATGCGGATACGAGGAAGACGATTCAGACCATCAAGGAGATCACTGCTGG
GAACTACAGCGAGGACGAGATTCACGCAATGCTCCTTGAATGCAGTATGAATCCCGATGAGGCTGCTCAACGCCTTCTTC
TTCAGGATCCATTCCTTGAGGTTAAGAAGAAACGTGATAAGAGAAAAGAGAACCTTAGCAGCAAGGACTCTGTTGAGCCA
CAGTGGAGATGTGGTGGTGGTGGTCGGATAAATTTATCTTCTCGTCACTCATCACATGGTAAACACCACTCAGATGGTGC
TGGTGCAAAGATTTTTTTCAGAAAAGAAAACGGTCCAAAGCAGGTCGCTCATCCATCAACTTCGACCTCTCAAAAACAAA
TAAAAACTAAAGACAATGCCTTGGTGTTTAGCCTTCCACCTGTGATGGATAAAAGTTCTGGTTGTTTGACATCAGGAAGC
TCTGATGGTGCACCACCATCTGCTGTTGAATCAAGCAAAAATCGTGTTAATACAGAGCAGAAGTCGGCTGATTCTTTGCC
ACTCTCTCGTCCACCATCCTCGGAGGTTCGATTCATTTCTTCAAATTCCAAACCAGTGAGCGAGCAACACCTTGGAGAAA
GAAAGTTACAAAACAGATCTCGTGGGACGGGGAACACTTTAGTGAATGATGCTTATGTTCCGAGGCCTGCTTCATCTCAT
AGCAACAGCACGAGTAGCCGGCCTTCTTCTAACTACAGTAATCGTTCACATCAGACCGTTGGTCCTCAAAGAGGTAAGGA
ATGGAAGCCGAAGCCAGTGAACCATACAACTACTCAGGGTTCTGGTGCATCAGCTACAGCTGAAGCTCTTGCGGTTCCTA
CTGAAGCCAGTGAAAAATCTGTTGAAGATGTTGTCCCTTCTGCAGAGGGCACATCTAAGTTGCAGAGGCAGCTTGAGGAC
TTGCAGGTCCAACGTCAGCATGTTATTATCCCAAACCATATCCTTGTTCCAGATGCTGAGCGAACCAAGTTCAGCTTTGG
AAGCTTTGATGCTGGCTTTTCTATAGCATCAAGTTCAGTAGCTTTTCCAGAGAATGAAAAGAGATCTGCACCTCTCTCTC
AGAATTCACAGGAGGTTGAAGATAGTTTTGAAGAAGACGAACTTAGCCACCCAAATGTCCATTCGACTGAAAAGGACGAG
GAGAACAATGTTTACTCCGAGTCGCCTTCACAAGTTCCAAATGATATGGCTGGTGAAGGTATCACCGCAGCAAACGCAGC
TCCAGTGTATGATGTCTCCAAGCAAGAGAATACGTTGGAGTCCGAAAGCAATCACAGCCCTTTTGACCACATTCCAAGTA
ATATTCTCGGGCCTATTCCTCCAGCTCCTGGGAGCCAGCTTCCACAGTTTGAGAATGCTGATCCTCAAGCACGTGATGCC
CTTCGTACTCCTAACTTTGTGGTCCAGCAACCATTTGATACAGCGAGTTACTATGCTCAATTCTACCGATCAGGCCCTGA
CAGTGATGGCCGTGTTTCTCCTTTTGTTTCTCCAGGGGTTGCGTCCAAGTTTAATGGAAATGTTACAGTATTGCCCCCTC
ATTCATCTCAAACCATGCAAGAGAGTGGAAACAACTTAGTTCTGTCGACAGCTAGTCCAACTCCACTGGCAACACAGCCT
GCTGGGCTGATGCAGAGCTCTATACCTGTCACGCAGCAGCCTGTTCCTTTCTTACGGCCCCCAGGGTTACACATGTCACA
TTATCCACCGAACTACATGCCATATGGACACTACTTCTCCCCATTCTATCTACCTCACCCGGCAATGCAACAGTTCTTAA
GCAACGGTGCATTTGCTCAGCAACCTCAGGCAAGCAGTGTGTATCCTGCTCCTCCTCCACCCTCTGGAGCTGCAACAGGA
GGCAAATACACACTCCCTCATCACAAGCCTGGGAGTAATACAGGAAACTTGACTCATGTTGGTATGCCTGGTGGTTACGG
ACCAACATCACATGGTTCCTTCCCAGCAGGATATAATCCCAATTCTGGTGCTTCAGCTGGGAACTCAACTTCCAATGAGG
ATCTCAGCACGTTGCAGTTGAAGGGAAACAACGGCTACAGCACAACAGGACAACAGAGTGAAGCATTACCTGTATGGATT
GCTGGACCAGGACGAGATGTGCCGAGCTCGTTCTACGGTTTACAGCACCATGGGCAACAGCACGTGACTTACGCTCCAGC
ACAATCCGGTCACGTGACATTCCCAGGTATGTATCATCCGGGACAAGCAGTGACAGCAGCTGGAGGAGTTCACCATCCGC
TCTTACAACAGTCTCAGGGTGTTGCTGGAGCCGAAATGGTTGCACCTGGGCCTCCTAACGTTTTCCAACAGCCTCAGCAA
ACACCGATGAATTGGCCAAGTAATTACTGA