Details for Kale Locus Bo5g141270

Position : C5 ( 5`- 43761990 .. 43763040 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141270

Protein [Map View]
MSMKATILILGLVWSFQAALGIRFVIDREECFSHKAEYEGDTLHVSFVVIKSDSQWHFNEDGVDLVIHGPAGEQIHDFRE
QISAKHDFVVQKKGVYRFCFTNKSPYHETIDFDVQLGHFAYYDQHAKDEHFTPLMEQISKLEEALYNIQFEQHWLEAQTD
RQAIVNENMSKRAVHKALFESFALIGASVLQVYLLRRLFERKLGMSRV*

DNA
ATGAGCATGAAGGCCACGATCCTAATACTAGGCCTCGTATGGAGCTTCCAGGCAGCGTTGGGGATTAGATTCGTGATAGA
CAGAGAAGAATGTTTCTCCCACAAGGCTGAGTATGAAGGCGATACCCTTCATGTCTCTTTCGTCGTCATCAAATCTGATT
CTCAATGGCATTTTAACGAGGATGGTGTAGATCTTGTGATACACGGCCCAGCAGGGGAACAGATTCATGACTTCAGGGAG
CAGATAAGTGCCAAGCACGACTTTGTTGTCCAAAAGAAAGGGGTTTACCGTTTTTGTTTCACAAACAAGTCTCCGTATCA
TGAAACCATTGACTTCGATGTGCAGCTTGGTCACTTTGCGTACTACGACCAGCACGCAAAGGACGAGCATTTCACTCCAT
TGATGGAGCAAATATCGAAGTTAGAGGAGGCTCTTTACAATATCCAGTTCGAACAACATTGGTTAGAGGCTCAGACTGAT
CGTCAAGCTATTGTGAACGAGAACATGAGCAAGAGAGCAGTACACAAAGCTTTGTTCGAGTCGTTTGCGTTGATCGGGGC
AAGTGTCCTCCAAGTTTATCTTCTGCGTCGCTTGTTTGAACGCAAACTCGGCATGTCTCGTGTCTAA