Details for Kale Locus Bo5g141250

Position : C5 ( 5`- 43748402 .. 43750660 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141250

Protein [Map View]
MEQLVEARLDEIRRVMCKADDDPLKIVGVGAGAWGSVFIAMLQENYGTFRDKVSVRIWRRGGRSIDKATAQHLFEVINSR
EELLRRLIRRCAYLKYVEARLGDRVLYADEILKDGFCLNMIETPLCPLKVVTNLQEAVWDADVVVNGLPSTETFQVFSEI
SKYWKERVTAPVIISLAKGVEAEFEPRPRIVTPTQMIYRATGIPLENILYLGGPNIASEVYNKEYANARICGSEKWRKPL
GKFLRQSHFIVWDNSDLVTHEVMGGLKNVYAIGAGMVDTLTKESATSKSVYFAHCTSEMIFITHLLAKEPEKLAGPLLAD
TYVTLLKGRNAWYGQKLAKGELNLQMGDSIKGKGMIQGVSAVKAFFELLNQSSLSLQHPEEGKPVTPAELCPILKMLYRI
LITREVSCEAVLEALRDETMNDPRELIEIAHSHLFFQPSLLGQTP*

DNA
ATGGAGCAATTGGTGGAAGCAAGGCTTGACGAGATCCGCAGAGTAATGTGCAAAGCCGACGACGATCCGTTAAAGATCGT
AGGCGTCGGAGCCGGCGCGTGGGGAAGCGTCTTCATCGCAATGCTACAAGAAAACTACGGAACATTCAGAGATAAAGTCA
GTGTTCGAATCTGGAGAAGAGGAGGGAGATCGATCGACAAAGCCACAGCTCAGCATCTCTTCGAAGTGATCAACTCGAGA
GAGGAGCTGCTCAGGAGGCTGATACGACGGTGCGCGTATCTCAAGTACGTGGAAGCTAGGCTAGGCGATAGAGTGCTGTA
CGCAGACGAGATATTGAAAGATGGGTTTTGTTTGAATATGATTGAGACTCCTCTGTGTCCTTTGAAAGTGGTGACGAATC
TGCAGGAGGCGGTTTGGGATGCTGATGTTGTTGTGAATGGTTTGCCTTCGACTGAGACGTTTCAGGTGTTTAGTGAGATT
AGTAAGTACTGGAAGGAGAGGGTTACGGCTCCTGTGATCATCTCTTTGGCTAAGGGAGTGGAAGCTGAGTTTGAGCCTCG
TCCTAGGATTGTTACTCCTACTCAGATGATCTATCGAGCGACTGGAATCCCTCTTGAGAACATTCTCTACCTTGGGGGAC
CTAACATTGCTTCCGAGGTATACAACAAAGAGTACGCTAATGCACGGATATGCGGGTCTGAGAAATGGAGGAAGCCTCTG
GGGAAGTTTCTAAGGCAGTCTCATTTCATAGTGTGGGATAACAGTGACCTTGTTACTCATGAAGTAATGGGTGGTTTGAA
AAATGTATACGCCATTGGCGCAGGAATGGTGGATACATTAACAAAGGAAAGTGCTACGAGCAAATCAGTGTACTTTGCGC
ATTGTACTTCTGAGATGATTTTTATTACTCATCTATTGGCCAAGGAGCCAGAGAAGCTTGCTGGGCCTTTGCTCGCGGAT
ACTTATGTAACGTTACTGAAAGGTCGTAATGCGTGGTATGGTCAGAAGCTCGCTAAAGGAGAACTTAACCTTCAAATGGG
TGATAGCATCAAGGGCAAGGGAATGATCCAGGGTGTTTCTGCGGTGAAAGCGTTTTTTGAGTTATTAAACCAATCCTCGT
TAAGTCTTCAACACCCTGAAGAAGGCAAACCTGTAACTCCTGCTGAGCTCTGTCCCATTTTGAAGATGCTCTACAGAATT
CTTATAACAAGGGAGGTCTCATGTGAGGCAGTTCTTGAGGCGCTGAGGGATGAGACAATGAATGACCCACGTGAACTCAT
CGAGATTGCTCACAGCCATCTCTTCTTCCAACCATCTCTTCTTGGTCAGACACCTTGA