Details for Kale Locus Bo5g141230

Position : C5 ( 5`- 43735119 .. 43736742 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141230

Protein [Map View]
MASTPMEGKWVQLKQKGTGPGARSSHAIVLVGNKVYAFGGEFQPRVPVDNHLHVFDLSTLTWSIQEASGDAPPPRVGVAM
AAVGTIIYFFGGRDENHQELNELYSFDTSTNEWKLLSSGETGPENRSYHSIATDSQNVYVFGGCGVDGRLNDLWAYNFVD
GKWIKFPSPGEGCKGRGGPGLEVVEGRIWVVYGFTGDEADDVHCFDIAKGEWKEVETKGEKPSARSVFSTSVVGKQIVIF
GGEVDPSDLGHMGAGCFTAEAYGLDTETLEWRKWEDGFGSEEHPGPRGWCAFAAGSRDGKEGLLVYGGNSPSNDRLDDIF
FFTPESY*

DNA
ATGGCATCGACTCCAATGGAAGGCAAATGGGTTCAGCTAAAACAGAAAGGAACCGGACCAGGAGCAAGAAGCTCACACGC
CATCGTCCTCGTTGGCAACAAAGTCTACGCCTTCGGCGGCGAGTTCCAACCCCGTGTCCCCGTCGACAACCACCTCCACG
TCTTCGACCTCAGCACTCTAACATGGTCCATCCAAGAAGCTTCAGGGGACGCTCCTCCTCCTAGAGTAGGCGTAGCCATG
GCTGCAGTAGGAACCATCATCTACTTCTTCGGCGGCCGCGACGAGAATCACCAAGAGCTCAACGAGCTTTACTCTTTCGA
CACTTCCACCAACGAGTGGAAGCTTCTCTCCTCAGGGGAGACAGGTCCTGAGAACAGAAGCTACCACTCCATAGCTACAG
ATTCTCAGAACGTGTATGTGTTTGGTGGGTGCGGAGTTGATGGCCGTCTTAACGATCTATGGGCGTACAATTTTGTTGAT
GGGAAGTGGATTAAGTTCCCGTCTCCTGGAGAGGGATGTAAAGGGAGAGGAGGTCCGGGACTAGAGGTGGTCGAAGGGAG
GATATGGGTTGTGTATGGATTCACAGGAGATGAAGCAGACGATGTTCATTGCTTCGACATAGCTAAAGGAGAGTGGAAAG
AAGTTGAGACAAAGGGTGAGAAACCGTCTGCGAGAAGTGTGTTTTCCACTTCCGTTGTTGGGAAACAGATTGTGATATTC
GGAGGAGAGGTTGATCCTAGCGACTTAGGACACATGGGAGCAGGGTGTTTCACAGCTGAGGCTTATGGGCTTGATACTGA
GACGTTGGAGTGGAGGAAGTGGGAAGATGGGTTTGGGTCAGAGGAGCATCCGGGGCCTAGAGGATGGTGTGCGTTTGCGG
CTGGGTCGAGGGATGGTAAGGAAGGTCTGTTGGTTTATGGAGGGAACTCGCCGAGTAATGATAGGCTTGATGATATCTTC
TTCTTCACTCCAGAATCTTACTAA