Details for Kale Locus Bo5g141220

Position : C5 ( 5`- 43732274 .. 43733686 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141220

Protein [Map View]
MKDVVIDDDVGNADSIMDSDDGRRTFMVNAVTNHHTPAMFQETDVPVLSLDDDDDDLKIDEDYKLHLDHLSDDNSLVPPS
EDDSKESETRRLRFNMVTNDANRSKRKIAELEAARDVPLASNMSEESTEDDETLWDVPLLRTLEVIKRDNEARKLAESTS
WDVPLVRAQEAIQRDNKARKMSETLWDVPLVRAQEVIQRGNKARRFLESKVDDTLRDVPLVRTKEVKALPVKRVHRVTEP
SMTQRNKRVCVGTRKKSVEEVVDKDYMSYLTWLVDSFEHPTTVVPEKDLSAKVKVEIDSWCSDDDDDDIIEVSDTPFTDG
ESTPFVVSKNKEVIDLEKDDSTDDESGSSSAFRRELIDVLEKPYDAGELLLLSSQASMKKPVSRCRELRKGRESSYETSE
LGLSYLEKVCDFDREYKLADGDDKARLELLRGFFFYLENISLPGAFKPWLPENMKKLGSKKAMLATIGRC*

DNA
ATGAAAGACGTTGTGATTGATGATGATGTTGGTAATGCAGACTCCATAATGGATAGTGATGATGGACGCAGAACGTTTAT
GGTGAATGCAGTTACTAACCATCATACTCCAGCTATGTTTCAAGAAACTGATGTTCCAGTTCTTTCTCTTGATGATGATG
ATGATGATCTCAAGATTGATGAGGACTACAAGCTGCACCTTGACCATCTTAGTGATGATAACAGTTTAGTCCCTCCCTCT
GAAGACGACAGTAAAGAATCTGAAACTCGTAGACTCAGATTCAACATGGTTACTAATGATGCAAACAGATCAAAGAGAAA
GATAGCTGAGTTAGAGGCTGCAAGGGATGTTCCTTTAGCTAGTAACATGTCAGAAGAGTCAACAGAGGATGATGAGACTT
TATGGGATGTTCCATTGCTTAGAACCCTAGAAGTCATCAAACGTGACAACGAAGCTAGGAAGCTGGCAGAGTCAACTTCA
TGGGATGTTCCATTGGTTAGAGCCCAAGAAGCCATACAAAGAGACAACAAAGCTAGAAAAATGTCAGAGACTTTATGGGA
TGTTCCCTTGGTTAGAGCTCAAGAAGTCATCCAACGAGGCAACAAAGCTAGGAGATTTTTGGAGTCAAAGGTTGATGACA
CTTTACGTGATGTTCCATTGGTTAGAACCAAAGAAGTGAAGGCTCTTCCTGTGAAGCGAGTACATAGAGTTACAGAGCCT
TCAATGACACAAAGAAACAAAAGAGTTTGTGTAGGGACAAGGAAGAAGAGTGTGGAAGAAGTTGTGGATAAGGACTACAT
GAGTTACCTCACATGGCTTGTAGACTCTTTTGAACATCCCACAACTGTTGTCCCTGAAAAGGATCTATCAGCAAAAGTAA
AGGTTGAGATTGATTCTTGGTGTTCTGATGATGATGATGATGATATAATTGAGGTTAGTGATACTCCATTCACAGATGGA
GAGAGCACACCTTTCGTGGTATCCAAGAACAAGGAAGTGATTGATCTTGAGAAAGATGATAGTACTGATGATGAAAGTGG
TAGTAGTAGTGCGTTTAGAAGGGAGCTAATAGATGTTCTTGAGAAACCATACGATGCAGGAGAGCTGTTGTTGTTGTCTA
GTCAGGCATCGATGAAGAAACCAGTGAGTAGATGTAGAGAGCTGAGAAAGGGAAGAGAGAGTAGCTATGAGACTTCTGAG
CTGGGACTGTCTTATCTGGAGAAGGTCTGTGATTTCGATAGAGAATACAAGCTTGCGGATGGTGATGATAAGGCGCGGTT
GGAGTTGCTGCGTGGTTTTTTCTTTTACTTGGAGAATATTTCTCTTCCTGGTGCTTTCAAGCCTTGGTTGCCAGAGAACA
TGAAGAAGCTAGGTTCGAAGAAAGCAATGCTTGCAACCATAGGAAGATGTTAG