Details for Kale Locus Bo5g141190

Position : C5 ( 5`- 43725217 .. 43726034 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g141190

Protein [Map View]
MIVSELYWDFCVEETMSRDHPPEPLDFFIWTVEDVGSWLEEINLGSYR

DNA
ATGATTGTGAGCGAGTTGTATTGGGACTTTTGTGTAGAGGAGACGATGAGCAGAGATCATCCACCCGAGCCTCTTGATTT
CTTCATCTGGACTGTTGAGGACGTTGGATCTTGGCTTGAGGAGATCAACCTTGGGAGCTACCGC