Details for Kale Locus Bo5g140190

Position : C5 ( 5`- 43708101 .. 43709561 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g140190

Protein [Map View]
MFLSPGHSPRHLSSPSPSSYSDDGLRTSSKIPPRNPRKRMRVLDEDAYVAAIEKIIERDYFPDISKLRDRLDWIQAVKTR
DPIQIRDAQLKIIERRGKKANHHGGDTVGDKTQTPGSTFLRSFTPLDEFDGSKTPREVQVVVADDGDGGVDVSNMSLDQF
FRRHTSEDNDSFSNILEKVNKRKKEKYGYLLESGDVIEDVKRDRITDGYGTSYQPPSTLQGWKYTAKNLLMYHPADRGEW
PLTQEERAVRLAGLTKEIVKANTRFQGKTMDCRPREDGSVEILYTPIAGSSPMLQVRDRDKSKRYDLDDLRKTPNPFYVE
SDKKAGNGYSFVKTPSPAPGLDESPFITWGEIEGTPMRLDSEDTPLDIGGSADGPHYNIPSAPARDVRAHSLSRDASRRL
RERSNSMFKKPPLPPSPYHRSGSASPNVRTLSPAAQKFFRRAIRKSSSAVDESLRASYRGASPGAVTPKSVSRFGKDRIT
PGSRSP*

DNA
ATGTTTCTATCGCCTGGCCACTCTCCACGTCACCTATCTTCTCCGTCTCCGTCTTCTTACTCCGACGACGGTCTCCGCAC
CTCCTCAAAGATCCCACCTCGAAACCCTAGAAAGCGGATGAGAGTCCTCGACGAGGACGCCTACGTCGCAGCCATCGAGA
AAATCATCGAGCGCGATTACTTCCCCGATATCTCCAAGCTCAGGGACAGGCTCGATTGGATCCAGGCGGTTAAAACCCGC
GACCCGATTCAGATCCGAGACGCACAGTTAAAGATCATCGAGAGGCGTGGGAAGAAAGCTAATCATCACGGTGGGGACAC
GGTGGGTGATAAAACTCAAACACCTGGATCTACTTTCTTGAGAAGTTTCACTCCTTTAGATGAGTTCGATGGTTCTAAGA
CTCCTAGAGAAGTACAAGTAGTAGTTGCTGATGATGGAGATGGTGGTGTAGATGTTAGTAATATGTCGTTAGACCAGTTC
TTTAGGAGGCATACAAGTGAGGACAACGATAGCTTCTCGAATATCTTGGAGAAGGTTAATAAGAGGAAGAAGGAGAAGTA
TGGCTATCTTCTCGAAAGTGGTGATGTGATTGAGGATGTAAAGAGAGATAGGATTACAGATGGTTACGGTACTTCTTATC
AGCCACCGAGTACGTTACAAGGATGGAAGTATACAGCGAAGAATCTTCTCATGTACCATCCAGCTGATCGAGGGGAGTGG
CCACTGACACAAGAGGAGAGGGCTGTGAGGCTAGCTGGACTGACCAAGGAGATTGTTAAGGCCAATACACGTTTTCAGGG
GAAGACGATGGATTGCAGGCCGAGGGAAGATGGTTCTGTTGAGATTCTCTACACTCCTATCGCAGGCTCTTCCCCTATGC
TGCAGGTTAGGGATAGAGACAAGTCCAAGAGGTATGATCTTGACGATCTGAGGAAGACTCCGAATCCGTTTTATGTGGAG
TCGGATAAGAAGGCGGGCAACGGGTATAGTTTCGTCAAAACGCCGTCTCCTGCCCCTGGTCTGGACGAATCGCCTTTTAT
AACGTGGGGGGAGATCGAAGGGACGCCGATGCGGTTAGATTCAGAGGATACGCCTCTTGATATCGGCGGTAGCGCTGATG
GACCGCACTACAACATTCCCTCCGCGCCTGCGAGGGACGTGAGGGCGCATTCATTGTCGAGGGACGCTTCGAGGAGGCTG
AGGGAGAGGTCGAACAGTATGTTCAAGAAGCCTCCGTTGCCGCCGTCTCCTTATCATAGGAGTGGAAGCGCGAGTCCGAA
TGTGAGGACGCTTTCGCCCGCTGCTCAGAAGTTTTTCAGGCGGGCGATAAGGAAGTCTTCTTCTGCTGTTGATGAGAGCC
TTCGTGCGAGTTACCGTGGAGCGAGTCCTGGCGCTGTGACTCCTAAGAGTGTGTCGAGATTTGGGAAAGATAGGATCACC
CCGGGTTCAAGGTCGCCTTGA