Details for Kale Locus Bo5g140180

Position : C5 ( 5`- 43706710 .. 43707649 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g140180

Protein [Map View]
MATLKASVLLSDISKDEGHLGSGAIHVITGPMFSGKSTSLLRRIKTEISVGRSVAMVKSSKDTRYAKDSVVTHDGIGFPC
WALPDLMSFPERFGQDAYDKLDVIGIDEAQFFGDLYEFCCKVADVDGKTVIVAGLDGDYLRRRFGAILDIIPIADSVTKL
TARCEVCGQKGFFTLRKTCDTRIELIGGADVYMPVCRKHYVNNQIVINASKKVLDSDKERAESCVDTVAAMV*

DNA
ATGGCGACTCTCAAAGCTTCCGTTTTGCTCAGTGACATCTCCAAAGATGAGGGACATCTCGGATCCGGTGCCATTCATGT
TATCACGGGTCCTATGTTTTCCGGGAAATCCACATCTCTCCTCCGCCGAATCAAGACAGAGATCAGTGTCGGAAGAAGTG
TTGCGATGGTGAAATCGAGTAAGGATACGAGATACGCCAAGGATTCAGTGGTGACGCATGACGGAATCGGATTCCCTTGC
TGGGCTCTTCCAGATCTCATGTCGTTTCCCGAGAGATTCGGACAAGATGCTTACGACAAGCTTGATGTGATTGGTATTGA
CGAGGCACAGTTCTTCGGAGATCTTTATGAGTTTTGCTGCAAAGTCGCTGATGTTGATGGCAAAACTGTTATTGTTGCAG
GCCTTGATGGTGATTATCTAAGAAGGAGATTTGGTGCTATTCTTGATATTATACCAATAGCTGATTCTGTGACGAAGCTA
ACCGCGAGGTGTGAGGTTTGTGGACAGAAAGGTTTCTTCACTCTCAGAAAGACTTGTGACACCAGAATCGAGCTGATCGG
TGGAGCTGATGTCTATATGCCTGTTTGTCGTAAGCATTATGTCAATAATCAAATTGTCATCAATGCTTCAAAGAAAGTGT
TGGATTCTGACAAGGAAAGAGCTGAATCCTGTGTGGACACAGTTGCCGCTATGGTCTAA