Details for Kale Locus Bo5g140170

Position : C5 ( 5`- 43702026 .. 43703948 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g140170

Protein [Map View]
MQSDNGKLFIGGISWDTNEERLKEYFSTFGEVIEAVILKDRTTGRARGFGFVVFADPAVAEFVITEKHHIDGRLVEAKKA
VPRDDQNMVTRSNSSSIQGSPGPGARTRKIFVGGLPSSVTESDFKTYFEQFGTTTDVVVMYDHNTQRPRGFGFITYDTEE
AVDKVLLKTFHELNGKMVEVKRAVPKEMSPGPARSPLGAGYSYGVNRVNNLLNGYAQGFNPGAVGGYGLRMDGRFSPVGA
GRSGFANFGSGYGMNMNFDQGLPTGFTGGNGNLDYGRGMSPYYIGNTNRFGPGPAVGCEGGSGGGGGGGGNSSFFSSVTR
NLWGNNGGLSYNNNNNNAANSNSNSNTYMGGGGSTSGNNNTLSGGPFGNWGAPGGGGGGNNAVGNENAKFGYGGNGESGF
GYAARSIGPSKAAPSSSFSSASAGYDGAGLAEFYGNGAVYSDPTWRSPTPEAEGPASFSYGIGGGGGGGGPSSDVSARSS
SPGYVGSYKRQPNRGIAT*

DNA
ATGCAATCCGACAATGGAAAGCTGTTCATCGGAGGGATATCTTGGGACACCAATGAGGAACGTCTCAAGGAGTATTTCAG
CACCTTTGGTGAAGTCATCGAAGCTGTGATCTTGAAAGATCGCACCACTGGTCGTGCACGTGGCTTCGGCTTTGTTGTCT
TCGCTGATCCAGCTGTTGCTGAGTTTGTTATTACAGAGAAGCATCATATCGATGGAAGATTGGTTGAAGCCAAGAAGGCT
GTTCCTAGAGATGACCAGAACATGGTAACTAGAAGCAACAGCAGCAGCATCCAAGGATCACCTGGTCCAGGAGCTCGGAC
AAGGAAGATATTCGTCGGAGGGCTACCTTCCTCCGTCACAGAGAGCGATTTCAAGACCTACTTTGAGCAGTTCGGGACAA
CAACAGACGTGGTTGTTATGTACGACCACAACACACAAAGGCCTAGAGGTTTCGGATTCATAACTTACGACACCGAGGAG
GCGGTTGATAAAGTGCTGCTCAAGACGTTCCATGAGCTCAACGGTAAAATGGTTGAGGTTAAGAGGGCTGTGCCGAAGGA
GATGTCTCCAGGTCCAGCTCGTAGCCCTCTTGGTGCTGGCTACAGCTATGGTGTTAATAGGGTTAATAACCTCTTGAATG
GATATGCTCAAGGGTTTAATCCGGGTGCGGTTGGTGGCTACGGGCTTAGGATGGATGGCCGGTTTAGTCCGGTTGGTGCT
GGGAGAAGCGGGTTTGCGAATTTCGGTTCTGGCTATGGGATGAATATGAACTTTGATCAGGGGTTGCCCACAGGGTTCAC
TGGAGGTAATGGAAACTTAGACTATGGGCGAGGGATGAGTCCTTACTACATTGGGAACACGAACCGGTTTGGTCCTGGTC
CTGCTGTTGGTTGTGAAGGAGGCAGTGGAGGAGGAGGAGGAGGAGGAGGGAACTCGTCCTTCTTCAGTTCGGTTACAAGG
AACCTATGGGGAAACAACGGTGGTCTTAGCTATAACAACAACAACAACAACGCTGCAAACTCAAACTCAAACTCCAATAC
ATACATGGGAGGAGGAGGATCAACAAGTGGGAACAACAACACGCTTAGCGGCGGGCCGTTTGGAAACTGGGGTGCTCCTG
GAGGTGGAGGTGGAGGAAACAATGCTGTTGGTAACGAGAATGCGAAGTTTGGTTATGGAGGAAACGGTGAATCTGGTTTT
GGGTATGCAGCAAGGAGCATAGGGCCTAGCAAGGCAGCACCGTCGTCTTCCTTCTCTTCTGCCTCGGCGGGTTATGATGG
AGCAGGACTTGCAGAGTTTTACGGAAATGGTGCAGTGTATAGTGATCCCACTTGGAGATCACCAACTCCTGAGGCAGAAG
GGCCTGCTTCTTTTAGCTATGGGATTGGAGGAGGAGGAGGAGGAGGAGGTCCTTCTTCTGATGTGTCAGCTAGAAGTTCA
TCTCCAGGTTATGTTGGCAGTTACAAGAGACAACCAAACAGAGGAATTGCTACTTAG